| Title: | Biological Sequences Retrieval and Analysis |
|---|---|
| Description: | Exploratory data analysis and data visualization for biological sequence (DNA and protein) data. Seqinr includes utilities for sequence data management under the ACNUC system described in Gouy, M. et al. (1984) Nucleic Acids Res. 12:121-127 <doi:10.1093/nar/12.1Part1.121>. |
| Authors: | Delphine Charif [aut], Olivier Clerc [ctb], Carolin Frank [ctb], Jean R. Lobry [aut, cph], Anamaria Necşulea [ctb], Leonor Palmeira [ctb], Simon Penel [cre], Guy Perrière [ctb] |
| Maintainer: | Simon Penel <[email protected]> |
| License: | GPL (>= 2) |
| Version: | 4.2-44 |
| Built: | 2026-05-28 06:15:04 UTC |
| Source: | https://github.com/lbbe-software/seqinr |
Exploratory data analysis and data visualization for biological sequence (DNA and protein) data. Include also utilities for sequence data management under the ACNUC system.
Delphine Charif [aut], Olivier Clerc [ctb], Carolin Frank [ctb], Jean R. Lobry [aut], Anamaria Necşulea [ctb], Leonor Palmeira [ctb], Simon Penel [cre], Guy Perrière [ctb]
citation('seqinr')
This is a vectorized function to convert three-letters amino-acid code into the one-letter one, for instance "Ala" into "A".
a(aa)a(aa)
aa |
A vector of string. All strings are 3 chars long. |
Allowed character values for aa are given by aaa().
All other values will generate a warning and return NA.
Called without arguments, a() returns the list of all possible
output values.
A vector of single characters.
D. Charif, J.R. Lobry
The IUPAC one-letter code for aminoacids is described at:
https://www.bioinformatics.org/sms/iupac.htmlcitation("seqinr")
# # Show all possible input values: # aaa() # # Convert them in one letter-code: # a(aaa()) # # Check consistency of results: # stopifnot( aaa(a(aaa())) == aaa()) # # Show what happens with non-allowed values: # a("SOS") # should be NA and a warning is generated# # Show all possible input values: # aaa() # # Convert them in one letter-code: # a(aaa()) # # Check consistency of results: # stopifnot( aaa(a(aaa())) == aaa()) # # Show what happens with non-allowed values: # a("SOS") # should be NA and a warning is generated
This is a vectorized function to convert one-letter amino-acid code into the three-letter one, for instance "A" into "Ala".
aaa(aa)aaa(aa)
aa |
A vector of single characters. |
Allowed character values for aa are given by a().
All other values will generate a warning and return NA.
Called without arguments, aaa() returns the list of
all possible output values.
A vector of char string. All strings are 3 chars long.
J.R. Lobry
The IUPAC one-letter code for aminoacids is described at:
https://www.bioinformatics.org/sms/iupac.html
citation("seqinr")
# # Show all possible input values: # a() # # Convert them in one letter-code: # aaa(a()) # # Check consistency of results: # stopifnot(a(aaa(a())) == a()) # # Show what happens with non-allowed values: # aaa("Z") # should be NA and a warning is generated# # Show all possible input values: # a() # # Convert them in one letter-code: # aaa(a()) # # Check consistency of results: # stopifnot(a(aaa(a())) == a()) # # Show what happens with non-allowed values: # aaa("Z") # should be NA and a warning is generated
The metabolic cost of amino-acid biosynthesis in E. coli under aerobic conditions from table 1 in Akashi and Gojobori (2002). The G+C classes are from Lobry (1997).
data(aacost)data(aacost)
A data frame with 20 rows for the amino-acids and the following 7 columns:
amino-acid (three-letters code).
amino-acid (one-letter code).
precursor metabolites (see details).
number of high-energy phosphate bonds contained in ATP and GTP molecules.
number of available hydrogen atoms carried in NADH, NADPH, and FADH2 molcules.
total metabolic cost assuming 2 high-energy phosphate bonds per hydrogen atom.
an ordered factor (l<m<h) for the G+C class of the amino-acid (see details)
Precursor metabolites are: penP, ribose 5-phosphate; PRPP,
5-phosphoribosyl pyrophosphate; eryP, erythrose 4-phosphate; 3pg,
3-phosphoglycerate; pep, phosphoenolpyruvate; pyr, pyruvate;
acCoA, acetyl-CoA; akg, alpha-ketoglutarate; oaa, oxaloacetate. Negative
signs on precursor metabolites indicate chemicals gained through
biosynthetic pathways. Costs of precursors reflect averages for growth on
glucose, acetate, and malate (see Table 6 in the supporting information
from Akashi and Gojobori 2002).
The levels l<m<h for the gc ordered factor stand for Low G+C, Middle G+C,
High G+C amino-acid, respectively. The frequencies of Low G+C amino-acids
monotonously decrease with G+C content. The frequencies of High G+C amino-
acids monotonously increase with G+C content. The frequencies of Middle G+C
amino-acids first increase and then decrease with G+C content. These G+C classes
are from Lobry (1997).
example(aacost) reproduces figure 2 from Lobry (2004).
Akashi, H, Gojobori, T. (2002) Metabolic efficiency and amino acid composition
in the proteomes of Escherichia coli and Bacillus subtilis.
Proceedings of the National Academy of Sciences of the United States of America,
99:3695-3700.
Lobry, J.R. (1997) Influence of genomic G+C content on average amino-acid composition
of proteins from 59 bacterial species. Gene, 205:309-316.
Lobry, J.R. (2004) Life history traits and genome structure: aerobiosis and G+C content in bacteria. Lecture Notes in Computer Sciences, 3039:679-686.
citation("seqinr")
data(aacost) levels(aacost$gc) <- c("low G+C", "mid G+C", "high G+C") stripchart(aacost$tot~aacost$gc, pch = 19, ylim = c(0.5,3.5), xlim = c(0, max(aacost$tot)), xlab = "Metabolic cost (high-energy phosphate bonds equivalent)", main = "Metabolic cost of the 20 amino-acids\nas function of their G+C class" ) boxplot(aacost$tot~aacost$gc, horizontal = TRUE, add = TRUE)data(aacost) levels(aacost$gc) <- c("low G+C", "mid G+C", "high G+C") stripchart(aacost$tot~aacost$gc, pch = 19, ylim = c(0.5,3.5), xlim = c(0, max(aacost$tot)), xlab = "Metabolic cost (high-energy phosphate bonds equivalent)", main = "Metabolic cost of the 20 amino-acids\nas function of their G+C class" ) boxplot(aacost$tot~aacost$gc, horizontal = TRUE, add = TRUE)
Data were imported from release 9.1 (AUG 2006) of the aaindex1 database. See the reference section to cite this database in a publication.
data(aaindex)data(aaindex)
A named list with 544 elements having each the following components:
String: Accession number in the aaindex database.
String: Data description.
String: LITDB entry number.
String: Author(s).
String: Title of the article.
String: Journal reference and comments.
String: Accession numbers of similar entries with the correlation coefficients of 0.8 (-0.8) or more (less). Notice: The correlation coefficient is calculated with zeros filled for missing values.
Numeric named vector: amino acid index data.
A short description of each entry is available under the D component:
alpha-CH chemical shifts (Andersen et al., 1992)
Hydrophobicity index (Argos et al., 1982)
Signal sequence helical potential (Argos et al., 1982)
Membrane-buried preference parameters (Argos et al., 1982)
Conformational parameter of inner helix (Beghin-Dirkx, 1975)
Conformational parameter of beta-structure (Beghin-Dirkx, 1975)
Conformational parameter of beta-turn (Beghin-Dirkx, 1975)
Average flexibility indices (Bhaskaran-Ponnuswamy, 1988)
Residue volume (Bigelow, 1967)
Information value for accessibility; average fraction 35
Information value for accessibility; average fraction 23
Retention coefficient in TFA (Browne et al., 1982)
Retention coefficient in HFBA (Browne et al., 1982)
Transfer free energy to surface (Bull-Breese, 1974)
Apparent partial specific volume (Bull-Breese, 1974)
alpha-NH chemical shifts (Bundi-Wuthrich, 1979)
alpha-CH chemical shifts (Bundi-Wuthrich, 1979)
Spin-spin coupling constants 3JHalpha-NH (Bundi-Wuthrich, 1979)
Normalized frequency of alpha-helix (Burgess et al., 1974)
Normalized frequency of extended structure (Burgess et al., 1974)
Steric parameter (Charton, 1981)
Polarizability parameter (Charton-Charton, 1982)
Free energy of solution in water, kcal/mole (Charton-Charton, 1982)
The Chou-Fasman parameter of the coil conformation (Charton-Charton, 1983)
A parameter defined from the residuals obtained from the best correlation of the Chou-Fasman parameter of beta-sheet (Charton-Charton, 1983)
The number of atoms in the side chain labelled 1+1 (Charton-Charton, 1983)
The number of atoms in the side chain labelled 2+1 (Charton-Charton, 1983)
The number of atoms in the side chain labelled 3+1 (Charton-Charton, 1983)
The number of bonds in the longest chain (Charton-Charton, 1983)
A parameter of charge transfer capability (Charton-Charton, 1983)
A parameter of charge transfer donor capability (Charton-Charton, 1983)
Average volume of buried residue (Chothia, 1975)
Residue accessible surface area in tripeptide (Chothia, 1976)
Residue accessible surface area in folded protein (Chothia, 1976)
Proportion of residues 95
Proportion of residues 100
Normalized frequency of beta-turn (Chou-Fasman, 1978a)
Normalized frequency of alpha-helix (Chou-Fasman, 1978b)
Normalized frequency of beta-sheet (Chou-Fasman, 1978b)
Normalized frequency of beta-turn (Chou-Fasman, 1978b)
Normalized frequency of N-terminal helix (Chou-Fasman, 1978b)
Normalized frequency of C-terminal helix (Chou-Fasman, 1978b)
Normalized frequency of N-terminal non helical region (Chou-Fasman, 1978b)
Normalized frequency of C-terminal non helical region (Chou-Fasman, 1978b)
Normalized frequency of N-terminal beta-sheet (Chou-Fasman, 1978b)
Normalized frequency of C-terminal beta-sheet (Chou-Fasman, 1978b)
Normalized frequency of N-terminal non beta region (Chou-Fasman, 1978b)
Normalized frequency of C-terminal non beta region (Chou-Fasman, 1978b)
Frequency of the 1st residue in turn (Chou-Fasman, 1978b)
Frequency of the 2nd residue in turn (Chou-Fasman, 1978b)
Frequency of the 3rd residue in turn (Chou-Fasman, 1978b)
Frequency of the 4th residue in turn (Chou-Fasman, 1978b)
Normalized frequency of the 2nd and 3rd residues in turn (Chou-Fasman, 1978b)
Normalized hydrophobicity scales for alpha-proteins (Cid et al., 1992)
Normalized hydrophobicity scales for beta-proteins (Cid et al., 1992)
Normalized hydrophobicity scales for alpha+beta-proteins (Cid et al., 1992)
Normalized hydrophobicity scales for alpha/beta-proteins (Cid et al., 1992)
Normalized average hydrophobicity scales (Cid et al., 1992)
Partial specific volume (Cohn-Edsall, 1943)
Normalized frequency of middle helix (Crawford et al., 1973)
Normalized frequency of beta-sheet (Crawford et al., 1973)
Normalized frequency of turn (Crawford et al., 1973)
Size (Dawson, 1972)
Amino acid composition (Dayhoff et al., 1978a)
Relative mutability (Dayhoff et al., 1978b)
Membrane preference for cytochrome b: MPH89 (Degli Esposti et al., 1990)
Average membrane preference: AMP07 (Degli Esposti et al., 1990)
Consensus normalized hydrophobicity scale (Eisenberg, 1984)
Solvation free energy (Eisenberg-McLachlan, 1986)
Atom-based hydrophobic moment (Eisenberg-McLachlan, 1986)
Direction of hydrophobic moment (Eisenberg-McLachlan, 1986)
Molecular weight (Fasman, 1976)
Melting point (Fasman, 1976)
Optical rotation (Fasman, 1976)
pK-N (Fasman, 1976)
pK-C (Fasman, 1976)
Hydrophobic parameter pi (Fauchere-Pliska, 1983)
Graph shape index (Fauchere et al., 1988)
Smoothed upsilon steric parameter (Fauchere et al., 1988)
Normalized van der Waals volume (Fauchere et al., 1988)
STERIMOL length of the side chain (Fauchere et al., 1988)
STERIMOL minimum width of the side chain (Fauchere et al., 1988)
STERIMOL maximum width of the side chain (Fauchere et al., 1988)
N.m.r. chemical shift of alpha-carbon (Fauchere et al., 1988)
Localized electrical effect (Fauchere et al., 1988)
Number of hydrogen bond donors (Fauchere et al., 1988)
Number of full nonbonding orbitals (Fauchere et al., 1988)
Positive charge (Fauchere et al., 1988)
Negative charge (Fauchere et al., 1988)
pK-a(RCOOH) (Fauchere et al., 1988)
Helix-coil equilibrium constant (Finkelstein-Ptitsyn, 1977)
Helix initiation parameter at posision i-1 (Finkelstein et al., 1991)
Helix initiation parameter at posision i,i+1,i+2 (Finkelstein et al., 1991)
Helix termination parameter at posision j-2,j-1,j (Finkelstein et al., 1991)
Helix termination parameter at posision j+1 (Finkelstein et al., 1991)
Partition coefficient (Garel et al., 1973)
Alpha-helix indices (Geisow-Roberts, 1980)
Alpha-helix indices for alpha-proteins (Geisow-Roberts, 1980)
Alpha-helix indices for beta-proteins (Geisow-Roberts, 1980)
Alpha-helix indices for alpha/beta-proteins (Geisow-Roberts, 1980)
Beta-strand indices (Geisow-Roberts, 1980)
Beta-strand indices for beta-proteins (Geisow-Roberts, 1980)
Beta-strand indices for alpha/beta-proteins (Geisow-Roberts, 1980)
Aperiodic indices (Geisow-Roberts, 1980)
Aperiodic indices for alpha-proteins (Geisow-Roberts, 1980)
Aperiodic indices for beta-proteins (Geisow-Roberts, 1980)
Aperiodic indices for alpha/beta-proteins (Geisow-Roberts, 1980)
Hydrophobicity factor (Goldsack-Chalifoux, 1973)
Residue volume (Goldsack-Chalifoux, 1973)
Composition (Grantham, 1974)
Polarity (Grantham, 1974)
Volume (Grantham, 1974)
Partition energy (Guy, 1985)
Hydration number (Hopfinger, 1971), Cited by Charton-Charton (1982)
Hydrophilicity value (Hopp-Woods, 1981)
Heat capacity (Hutchens, 1970)
Absolute entropy (Hutchens, 1970)
Entropy of formation (Hutchens, 1970)
Normalized relative frequency of alpha-helix (Isogai et al., 1980)
Normalized relative frequency of extended structure (Isogai et al., 1980)
Normalized relative frequency of bend (Isogai et al., 1980)
Normalized relative frequency of bend R (Isogai et al., 1980)
Normalized relative frequency of bend S (Isogai et al., 1980)
Normalized relative frequency of helix end (Isogai et al., 1980)
Normalized relative frequency of double bend (Isogai et al., 1980)
Normalized relative frequency of coil (Isogai et al., 1980)
Average accessible surface area (Janin et al., 1978)
Percentage of buried residues (Janin et al., 1978)
Percentage of exposed residues (Janin et al., 1978)
Ratio of buried and accessible molar fractions (Janin, 1979)
Transfer free energy (Janin, 1979)
Hydrophobicity (Jones, 1975)
pK (-COOH) (Jones, 1975)
Relative frequency of occurrence (Jones et al., 1992)
Relative mutability (Jones et al., 1992)
Amino acid distribution (Jukes et al., 1975)
Sequence frequency (Jungck, 1978)
Average relative probability of helix (Kanehisa-Tsong, 1980)
Average relative probability of beta-sheet (Kanehisa-Tsong, 1980)
Average relative probability of inner helix (Kanehisa-Tsong, 1980)
Average relative probability of inner beta-sheet (Kanehisa-Tsong, 1980)
Flexibility parameter for no rigid neighbors (Karplus-Schulz, 1985)
Flexibility parameter for one rigid neighbor (Karplus-Schulz, 1985)
Flexibility parameter for two rigid neighbors (Karplus-Schulz, 1985)
The Kerr-constant increments (Khanarian-Moore, 1980)
Net charge (Klein et al., 1984)
Side chain interaction parameter (Krigbaum-Rubin, 1971)
Side chain interaction parameter (Krigbaum-Komoriya, 1979)
Fraction of site occupied by water (Krigbaum-Komoriya, 1979)
Side chain volume (Krigbaum-Komoriya, 1979)
Hydropathy index (Kyte-Doolittle, 1982)
Transfer free energy, CHP/water (Lawson et al., 1984)
Hydrophobic parameter (Levitt, 1976)
Distance between C-alpha and centroid of side chain (Levitt, 1976)
Side chain angle theta(AAR) (Levitt, 1976)
Side chain torsion angle phi(AAAR) (Levitt, 1976)
Radius of gyration of side chain (Levitt, 1976)
van der Waals parameter R0 (Levitt, 1976)
van der Waals parameter epsilon (Levitt, 1976)
Normalized frequency of alpha-helix, with weights (Levitt, 1978)
Normalized frequency of beta-sheet, with weights (Levitt, 1978)
Normalized frequency of reverse turn, with weights (Levitt, 1978)
Normalized frequency of alpha-helix, unweighted (Levitt, 1978)
Normalized frequency of beta-sheet, unweighted (Levitt, 1978)
Normalized frequency of reverse turn, unweighted (Levitt, 1978)
Frequency of occurrence in beta-bends (Lewis et al., 1971)
Conformational preference for all beta-strands (Lifson-Sander, 1979)
Conformational preference for parallel beta-strands (Lifson-Sander, 1979)
Conformational preference for antiparallel beta-strands (Lifson-Sander, 1979)
Average surrounding hydrophobicity (Manavalan-Ponnuswamy, 1978)
Normalized frequency of alpha-helix (Maxfield-Scheraga, 1976)
Normalized frequency of extended structure (Maxfield-Scheraga, 1976)
Normalized frequency of zeta R (Maxfield-Scheraga, 1976)
Normalized frequency of left-handed alpha-helix (Maxfield-Scheraga, 1976)
Normalized frequency of zeta L (Maxfield-Scheraga, 1976)
Normalized frequency of alpha region (Maxfield-Scheraga, 1976)
Refractivity (McMeekin et al., 1964), Cited by Jones (1975)
Retention coefficient in HPLC, pH7.4 (Meek, 1980)
Retention coefficient in HPLC, pH2.1 (Meek, 1980)
Retention coefficient in NaClO4 (Meek-Rossetti, 1981)
Retention coefficient in NaH2PO4 (Meek-Rossetti, 1981)
Average reduced distance for C-alpha (Meirovitch et al., 1980)
Average reduced distance for side chain (Meirovitch et al., 1980)
Average side chain orientation angle (Meirovitch et al., 1980)
Effective partition energy (Miyazawa-Jernigan, 1985)
Normalized frequency of alpha-helix (Nagano, 1973)
Normalized frequency of bata-structure (Nagano, 1973)
Normalized frequency of coil (Nagano, 1973)
AA composition of total proteins (Nakashima et al., 1990)
SD of AA composition of total proteins (Nakashima et al., 1990)
AA composition of mt-proteins (Nakashima et al., 1990)
Normalized composition of mt-proteins (Nakashima et al., 1990)
AA composition of mt-proteins from animal (Nakashima et al., 1990)
Normalized composition from animal (Nakashima et al., 1990)
AA composition of mt-proteins from fungi and plant (Nakashima et al., 1990)
Normalized composition from fungi and plant (Nakashima et al., 1990)
AA composition of membrane proteins (Nakashima et al., 1990)
Normalized composition of membrane proteins (Nakashima et al., 1990)
Transmembrane regions of non-mt-proteins (Nakashima et al., 1990)
Transmembrane regions of mt-proteins (Nakashima et al., 1990)
Ratio of average and computed composition (Nakashima et al., 1990)
AA composition of CYT of single-spanning proteins (Nakashima-Nishikawa, 1992)
AA composition of CYT2 of single-spanning proteins (Nakashima-Nishikawa, 1992)
AA composition of EXT of single-spanning proteins (Nakashima-Nishikawa, 1992)
AA composition of EXT2 of single-spanning proteins (Nakashima-Nishikawa, 1992)
AA composition of MEM of single-spanning proteins (Nakashima-Nishikawa, 1992)
AA composition of CYT of multi-spanning proteins (Nakashima-Nishikawa, 1992)
AA composition of EXT of multi-spanning proteins (Nakashima-Nishikawa, 1992)
AA composition of MEM of multi-spanning proteins (Nakashima-Nishikawa, 1992)
8 A contact number (Nishikawa-Ooi, 1980)
14 A contact number (Nishikawa-Ooi, 1986)
Transfer energy, organic solvent/water (Nozaki-Tanford, 1971)
Average non-bonded energy per atom (Oobatake-Ooi, 1977)
Short and medium range non-bonded energy per atom (Oobatake-Ooi, 1977)
Long range non-bonded energy per atom (Oobatake-Ooi, 1977)
Average non-bonded energy per residue (Oobatake-Ooi, 1977)
Short and medium range non-bonded energy per residue (Oobatake-Ooi, 1977)
Optimized beta-structure-coil equilibrium constant (Oobatake et al., 1985)
Optimized propensity to form reverse turn (Oobatake et al., 1985)
Optimized transfer energy parameter (Oobatake et al., 1985)
Optimized average non-bonded energy per atom (Oobatake et al., 1985)
Optimized side chain interaction parameter (Oobatake et al., 1985)
Normalized frequency of alpha-helix from LG (Palau et al., 1981)
Normalized frequency of alpha-helix from CF (Palau et al., 1981)
Normalized frequency of beta-sheet from LG (Palau et al., 1981)
Normalized frequency of beta-sheet from CF (Palau et al., 1981)
Normalized frequency of turn from LG (Palau et al., 1981)
Normalized frequency of turn from CF (Palau et al., 1981)
Normalized frequency of alpha-helix in all-alpha class (Palau et al., 1981)
Normalized frequency of alpha-helix in alpha+beta class (Palau et al., 1981)
Normalized frequency of alpha-helix in alpha/beta class (Palau et al., 1981)
Normalized frequency of beta-sheet in all-beta class (Palau et al., 1981)
Normalized frequency of beta-sheet in alpha+beta class (Palau et al., 1981)
Normalized frequency of beta-sheet in alpha/beta class (Palau et al., 1981)
Normalized frequency of turn in all-alpha class (Palau et al., 1981)
Normalized frequency of turn in all-beta class (Palau et al., 1981)
Normalized frequency of turn in alpha+beta class (Palau et al., 1981)
Normalized frequency of turn in alpha/beta class (Palau et al., 1981)
HPLC parameter (Parker et al., 1986)
Partition coefficient (Pliska et al., 1981)
Surrounding hydrophobicity in folded form (Ponnuswamy et al., 1980)
Average gain in surrounding hydrophobicity (Ponnuswamy et al., 1980)
Average gain ratio in surrounding hydrophobicity (Ponnuswamy et al., 1980)
Surrounding hydrophobicity in alpha-helix (Ponnuswamy et al., 1980)
Surrounding hydrophobicity in beta-sheet (Ponnuswamy et al., 1980)
Surrounding hydrophobicity in turn (Ponnuswamy et al., 1980)
Accessibility reduction ratio (Ponnuswamy et al., 1980)
Average number of surrounding residues (Ponnuswamy et al., 1980)
Intercept in regression analysis (Prabhakaran-Ponnuswamy, 1982)
Slope in regression analysis x 1.0E1 (Prabhakaran-Ponnuswamy, 1982)
Correlation coefficient in regression analysis (Prabhakaran-Ponnuswamy, 1982)
Hydrophobicity (Prabhakaran, 1990)
Relative frequency in alpha-helix (Prabhakaran, 1990)
Relative frequency in beta-sheet (Prabhakaran, 1990)
Relative frequency in reverse-turn (Prabhakaran, 1990)
Helix-coil equilibrium constant (Ptitsyn-Finkelstein, 1983)
Beta-coil equilibrium constant (Ptitsyn-Finkelstein, 1983)
Weights for alpha-helix at the window position of -6 (Qian-Sejnowski, 1988)
Weights for alpha-helix at the window position of -5 (Qian-Sejnowski, 1988)
Weights for alpha-helix at the window position of -4 (Qian-Sejnowski, 1988)
Weights for alpha-helix at the window position of -3 (Qian-Sejnowski, 1988)
Weights for alpha-helix at the window position of -2 (Qian-Sejnowski, 1988)
Weights for alpha-helix at the window position of -1 (Qian-Sejnowski, 1988)
Weights for alpha-helix at the window position of 0 (Qian-Sejnowski, 1988)
Weights for alpha-helix at the window position of 1 (Qian-Sejnowski, 1988)
Weights for alpha-helix at the window position of 2 (Qian-Sejnowski, 1988)
Weights for alpha-helix at the window position of 3 (Qian-Sejnowski, 1988)
Weights for alpha-helix at the window position of 4 (Qian-Sejnowski, 1988)
Weights for alpha-helix at the window position of 5 (Qian-Sejnowski, 1988)
Weights for alpha-helix at the window position of 6 (Qian-Sejnowski, 1988)
Weights for beta-sheet at the window position of -6 (Qian-Sejnowski, 1988)
Weights for beta-sheet at the window position of -5 (Qian-Sejnowski, 1988)
Weights for beta-sheet at the window position of -4 (Qian-Sejnowski, 1988)
Weights for beta-sheet at the window position of -3 (Qian-Sejnowski, 1988)
Weights for beta-sheet at the window position of -2 (Qian-Sejnowski, 1988)
Weights for beta-sheet at the window position of -1 (Qian-Sejnowski, 1988)
Weights for beta-sheet at the window position of 0 (Qian-Sejnowski, 1988)
Weights for beta-sheet at the window position of 1 (Qian-Sejnowski, 1988)
Weights for beta-sheet at the window position of 2 (Qian-Sejnowski, 1988)
Weights for beta-sheet at the window position of 3 (Qian-Sejnowski, 1988)
Weights for beta-sheet at the window position of 4 (Qian-Sejnowski, 1988)
Weights for beta-sheet at the window position of 5 (Qian-Sejnowski, 1988)
Weights for beta-sheet at the window position of 6 (Qian-Sejnowski, 1988)
Weights for coil at the window position of -6 (Qian-Sejnowski, 1988)
Weights for coil at the window position of -5 (Qian-Sejnowski, 1988)
Weights for coil at the window position of -4 (Qian-Sejnowski, 1988)
Weights for coil at the window position of -3 (Qian-Sejnowski, 1988)
Weights for coil at the window position of -2 (Qian-Sejnowski, 1988)
Weights for coil at the window position of -1 (Qian-Sejnowski, 1988)
Weights for coil at the window position of 0 (Qian-Sejnowski, 1988)
Weights for coil at the window position of 1 (Qian-Sejnowski, 1988)
Weights for coil at the window position of 2 (Qian-Sejnowski, 1988)
Weights for coil at the window position of 3 (Qian-Sejnowski, 1988)
Weights for coil at the window position of 4 (Qian-Sejnowski, 1988)
Weights for coil at the window position of 5 (Qian-Sejnowski, 1988)
Weights for coil at the window position of 6 (Qian-Sejnowski, 1988)
Average reduced distance for C-alpha (Rackovsky-Scheraga, 1977)
Average reduced distance for side chain (Rackovsky-Scheraga, 1977)
Side chain orientational preference (Rackovsky-Scheraga, 1977)
Average relative fractional occurrence in A0(i) (Rackovsky-Scheraga, 1982)
Average relative fractional occurrence in AR(i) (Rackovsky-Scheraga, 1982)
Average relative fractional occurrence in AL(i) (Rackovsky-Scheraga, 1982)
Average relative fractional occurrence in EL(i) (Rackovsky-Scheraga, 1982)
Average relative fractional occurrence in E0(i) (Rackovsky-Scheraga, 1982)
Average relative fractional occurrence in ER(i) (Rackovsky-Scheraga, 1982)
Average relative fractional occurrence in A0(i-1) (Rackovsky-Scheraga, 1982)
Average relative fractional occurrence in AR(i-1) (Rackovsky-Scheraga, 1982)
Average relative fractional occurrence in AL(i-1) (Rackovsky-Scheraga, 1982)
Average relative fractional occurrence in EL(i-1) (Rackovsky-Scheraga, 1982)
Average relative fractional occurrence in E0(i-1) (Rackovsky-Scheraga, 1982)
Average relative fractional occurrence in ER(i-1) (Rackovsky-Scheraga, 1982)
Value of theta(i) (Rackovsky-Scheraga, 1982)
Value of theta(i-1) (Rackovsky-Scheraga, 1982)
Transfer free energy from chx to wat (Radzicka-Wolfenden, 1988)
Transfer free energy from oct to wat (Radzicka-Wolfenden, 1988)
Transfer free energy from vap to chx (Radzicka-Wolfenden, 1988)
Transfer free energy from chx to oct (Radzicka-Wolfenden, 1988)
Transfer free energy from vap to oct (Radzicka-Wolfenden, 1988)
Accessible surface area (Radzicka-Wolfenden, 1988)
Energy transfer from out to in(95
Mean polarity (Radzicka-Wolfenden, 1988)
Relative preference value at N" (Richardson-Richardson, 1988)
Relative preference value at N' (Richardson-Richardson, 1988)
Relative preference value at N-cap (Richardson-Richardson, 1988)
Relative preference value at N1 (Richardson-Richardson, 1988)
Relative preference value at N2 (Richardson-Richardson, 1988)
Relative preference value at N3 (Richardson-Richardson, 1988)
Relative preference value at N4 (Richardson-Richardson, 1988)
Relative preference value at N5 (Richardson-Richardson, 1988)
Relative preference value at Mid (Richardson-Richardson, 1988)
Relative preference value at C5 (Richardson-Richardson, 1988)
Relative preference value at C4 (Richardson-Richardson, 1988)
Relative preference value at C3 (Richardson-Richardson, 1988)
Relative preference value at C2 (Richardson-Richardson, 1988)
Relative preference value at C1 (Richardson-Richardson, 1988)
Relative preference value at C-cap (Richardson-Richardson, 1988)
Relative preference value at C' (Richardson-Richardson, 1988)
Relative preference value at C" (Richardson-Richardson, 1988)
Information measure for alpha-helix (Robson-Suzuki, 1976)
Information measure for N-terminal helix (Robson-Suzuki, 1976)
Information measure for middle helix (Robson-Suzuki, 1976)
Information measure for C-terminal helix (Robson-Suzuki, 1976)
Information measure for extended (Robson-Suzuki, 1976)
Information measure for pleated-sheet (Robson-Suzuki, 1976)
Information measure for extended without H-bond (Robson-Suzuki, 1976)
Information measure for turn (Robson-Suzuki, 1976)
Information measure for N-terminal turn (Robson-Suzuki, 1976)
Information measure for middle turn (Robson-Suzuki, 1976)
Information measure for C-terminal turn (Robson-Suzuki, 1976)
Information measure for coil (Robson-Suzuki, 1976)
Information measure for loop (Robson-Suzuki, 1976)
Hydration free energy (Robson-Osguthorpe, 1979)
Mean area buried on transfer (Rose et al., 1985)
Mean fractional area loss (Rose et al., 1985)
Side chain hydropathy, uncorrected for solvation (Roseman, 1988)
Side chain hydropathy, corrected for solvation (Roseman, 1988)
Loss of Side chain hydropathy by helix formation (Roseman, 1988)
Transfer free energy (Simon, 1976), Cited by Charton-Charton (1982)
Principal component I (Sneath, 1966)
Principal component II (Sneath, 1966)
Principal component III (Sneath, 1966)
Principal component IV (Sneath, 1966)
Zimm-Bragg parameter s at 20 C (Sueki et al., 1984)
Zimm-Bragg parameter sigma x 1.0E4 (Sueki et al., 1984)
Optimal matching hydrophobicity (Sweet-Eisenberg, 1983)
Normalized frequency of alpha-helix (Tanaka-Scheraga, 1977)
Normalized frequency of isolated helix (Tanaka-Scheraga, 1977)
Normalized frequency of extended structure (Tanaka-Scheraga, 1977)
Normalized frequency of chain reversal R (Tanaka-Scheraga, 1977)
Normalized frequency of chain reversal S (Tanaka-Scheraga, 1977)
Normalized frequency of chain reversal D (Tanaka-Scheraga, 1977)
Normalized frequency of left-handed helix (Tanaka-Scheraga, 1977)
Normalized frequency of zeta R (Tanaka-Scheraga, 1977)
Normalized frequency of coil (Tanaka-Scheraga, 1977)
Normalized frequency of chain reversal (Tanaka-Scheraga, 1977)
Relative population of conformational state A (Vasquez et al., 1983)
Relative population of conformational state C (Vasquez et al., 1983)
Relative population of conformational state E (Vasquez et al., 1983)
Electron-ion interaction potential (Veljkovic et al., 1985)
Bitterness (Venanzi, 1984)
Transfer free energy to lipophilic phase (von Heijne-Blomberg, 1979)
Average interactions per side chain atom (Warme-Morgan, 1978)
RF value in high salt chromatography (Weber-Lacey, 1978)
Propensity to be buried inside (Wertz-Scheraga, 1978)
Free energy change of epsilon(i) to epsilon(ex) (Wertz-Scheraga, 1978)
Free energy change of alpha(Ri) to alpha(Rh) (Wertz-Scheraga, 1978)
Free energy change of epsilon(i) to alpha(Rh) (Wertz-Scheraga, 1978)
Polar requirement (Woese, 1973)
Hydration potential (Wolfenden et al., 1981)
Principal property value z1 (Wold et al., 1987)
Principal property value z2 (Wold et al., 1987)
Principal property value z3 (Wold et al., 1987)
Unfolding Gibbs energy in water, pH7.0 (Yutani et al., 1987)
Unfolding Gibbs energy in water, pH9.0 (Yutani et al., 1987)
Activation Gibbs energy of unfolding, pH7.0 (Yutani et al., 1987)
Activation Gibbs energy of unfolding, pH9.0 (Yutani et al., 1987)
Dependence of partition coefficient on ionic strength (Zaslavsky et al., 1982)
Hydrophobicity (Zimmerman et al., 1968)
Bulkiness (Zimmerman et al., 1968)
Polarity (Zimmerman et al., 1968)
Isoelectric point (Zimmerman et al., 1968)
RF rank (Zimmerman et al., 1968)
Normalized positional residue frequency at helix termini N4'(Aurora-Rose, 1998)
Normalized positional residue frequency at helix termini N"' (Aurora-Rose, 1998)
Normalized positional residue frequency at helix termini N" (Aurora-Rose, 1998)
Normalized positional residue frequency at helix termini N'(Aurora-Rose, 1998)
Normalized positional residue frequency at helix termini Nc (Aurora-Rose, 1998)
Normalized positional residue frequency at helix termini N1 (Aurora-Rose, 1998)
Normalized positional residue frequency at helix termini N2 (Aurora-Rose, 1998)
Normalized positional residue frequency at helix termini N3 (Aurora-Rose, 1998)
Normalized positional residue frequency at helix termini N4 (Aurora-Rose, 1998)
Normalized positional residue frequency at helix termini N5 (Aurora-Rose, 1998)
Normalized positional residue frequency at helix termini C5 (Aurora-Rose, 1998)
Normalized positional residue frequency at helix termini C4 (Aurora-Rose, 1998)
Normalized positional residue frequency at helix termini C3 (Aurora-Rose, 1998)
Normalized positional residue frequency at helix termini C2 (Aurora-Rose, 1998)
Normalized positional residue frequency at helix termini C1 (Aurora-Rose, 1998)
Normalized positional residue frequency at helix termini Cc (Aurora-Rose, 1998)
Normalized positional residue frequency at helix termini C' (Aurora-Rose, 1998)
Normalized positional residue frequency at helix termini C" (Aurora-Rose, 1998)
Normalized positional residue frequency at helix termini C"' (Aurora-Rose, 1998)
Normalized positional residue frequency at helix termini C4' (Aurora-Rose, 1998)
Delta G values for the peptides extrapolated to 0 M urea (O'Neil-DeGrado, 1990)
Helix formation parameters (delta delta G) (O'Neil-DeGrado, 1990)
Normalized flexibility parameters (B-values), average (Vihinen et al., 1994)
Normalized flexibility parameters (B-values) for each residue surrounded by none rigid neighbours (Vihinen et al., 1994)
Normalized flexibility parameters (B-values) for each residue surrounded by one rigid neighbours (Vihinen et al., 1994)
Normalized flexibility parameters (B-values) for each residue surrounded by two rigid neighbours (Vihinen et al., 1994)
Free energy in alpha-helical conformation (Munoz-Serrano, 1994)
Free energy in alpha-helical region (Munoz-Serrano, 1994)
Free energy in beta-strand conformation (Munoz-Serrano, 1994)
Free energy in beta-strand region (Munoz-Serrano, 1994)
Free energy in beta-strand region (Munoz-Serrano, 1994)
Free energies of transfer of AcWl-X-LL peptides from bilayer interface to water (Wimley-White, 1996)
Thermodynamic beta sheet propensity (Kim-Berg, 1993)
Turn propensity scale for transmembrane helices (Monne et al., 1999)
Alpha helix propensity of position 44 in T4 lysozyme (Blaber et al., 1993)
p-Values of mesophilic proteins based on the distributions of B values (Parthasarathy-Murthy, 2000)
p-Values of thermophilic proteins based on the distributions of B values (Parthasarathy-Murthy, 2000)
Distribution of amino acid residues in the 18 non-redundant families of thermophilic proteins (Kumar et al., 2000)
Distribution of amino acid residues in the 18 non-redundant families of mesophilic proteins (Kumar et al., 2000)
Distribution of amino acid residues in the alpha-helices in thermophilic proteins (Kumar et al., 2000)
Distribution of amino acid residues in the alpha-helices in mesophilic proteins (Kumar et al., 2000)
Side-chain contribution to protein stability (kJ/mol) (Takano-Yutani, 2001)
Propensity of amino acids within pi-helices (Fodje-Al-Karadaghi, 2002)
Hydropathy scale based on self-information values in the two-state model (5
Hydropathy scale based on self-information values in the two-state model (9
Hydropathy scale based on self-information values in the two-state model (16
Hydropathy scale based on self-information values in the two-state model (20
Hydropathy scale based on self-information values in the two-state model (25
Hydropathy scale based on self-information values in the two-state model (36
Hydropathy scale based on self-information values in the two-state model (50
Averaged turn propensities in a transmembrane helix (Monne et al., 1999)
Alpha-helix propensity derived from designed sequences (Koehl-Levitt, 1999)
Beta-sheet propensity derived from designed sequences (Koehl-Levitt, 1999)
Composition of amino acids in extracellular proteins (percent) (Cedano et al., 1997)
Composition of amino acids in anchored proteins (percent) (Cedano et al., 1997)
Composition of amino acids in membrane proteins (percent) (Cedano et al., 1997)
Composition of amino acids in intracellular proteins (percent) (Cedano et al., 1997)
Composition of amino acids in nuclear proteins (percent) (Cedano et al., 1997)
Surface composition of amino acids in intracellular proteins of thermophiles (percent) (Fukuchi-Nishikawa, 2001)
Surface composition of amino acids in intracellular proteins of mesophiles (percent) (Fukuchi-Nishikawa, 2001)
Surface composition of amino acids in extracellular proteins of mesophiles (percent) (Fukuchi-Nishikawa, 2001)
Surface composition of amino acids in nuclear proteins (percent) (Fukuchi-Nishikawa, 2001)
Interior composition of amino acids in intracellular proteins of thermophiles (percent) (Fukuchi-Nishikawa, 2001)
Interior composition of amino acids in intracellular proteins of mesophiles (percent) (Fukuchi-Nishikawa, 2001)
Interior composition of amino acids in extracellular proteins of mesophiles (percent) (Fukuchi-Nishikawa, 2001)
Interior composition of amino acids in nuclear proteins (percent) (Fukuchi-Nishikawa, 2001)
Entire chain composition of amino acids in intracellular proteins of thermophiles (percent) (Fukuchi-Nishikawa, 2001)
Entire chain composition of amino acids in intracellular proteins of mesophiles (percent) (Fukuchi-Nishikawa, 2001)
Entire chain composition of amino acids in extracellular proteins of mesophiles (percent) (Fukuchi-Nishikawa, 2001)
Entire chain compositino of amino acids in nuclear proteins (percent) (Fukuchi-Nishikawa, 2001)
Screening coefficients gamma, local (Avbelj, 2000)
Screening coefficients gamma, non-local (Avbelj, 2000)
Slopes tripeptide, FDPB VFF neutral (Avbelj, 2000)
Slopes tripeptides, LD VFF neutral (Avbelj, 2000)
Slopes tripeptide, FDPB VFF noside (Avbelj, 2000)
Slopes tripeptide FDPB VFF all (Avbelj, 2000)
Slopes tripeptide FDPB PARSE neutral (Avbelj, 2000)
Slopes dekapeptide, FDPB VFF neutral (Avbelj, 2000)
Slopes proteins, FDPB VFF neutral (Avbelj, 2000)
Side-chain conformation by gaussian evolutionary method (Yang et al., 2002)
Amphiphilicity index (Mitaku et al., 2002)
Volumes including the crystallographic waters using the ProtOr (Tsai et al., 1999)
Volumes not including the crystallographic waters using the ProtOr (Tsai et al., 1999)
Electron-ion interaction potential values (Cosic, 1994)
Hydrophobicity scales (Ponnuswamy, 1993)
Hydrophobicity coefficient in RP-HPLC, C18 with 0.1
Hydrophobicity coefficient in RP-HPLC, C8 with 0.1
Hydrophobicity coefficient in RP-HPLC, C4 with 0.1
Hydrophobicity coefficient in RP-HPLC, C18 with 0.1
Hydrophilicity scale (Kuhn et al., 1995)
Retention coefficient at pH 2 (Guo et al., 1986)
Modified Kyte-Doolittle hydrophobicity scale (Juretic et al., 1998)
Interactivity scale obtained from the contact matrix (Bastolla et al., 2005)
Interactivity scale obtained by maximizing the mean of correlation coefficient over single-domain globular proteins (Bastolla et al., 2005)
Interactivity scale obtained by maximizing the mean of correlation coefficient over pairs of sequences sharing the TIM barrel fold (Bastolla et al., 2005)
Linker propensity index (Suyama-Ohara, 2003)
Knowledge-based membrane-propensity scale from 1D Helix in MPtopo databases (Punta-Maritan, 2003)
Knowledge-based membrane-propensity scale from 3D Helix in MPtopo databases (Punta-Maritan, 2003)
Linker propensity from all dataset (George-Heringa, 2003)
Linker propensity from 1-linker dataset (George-Heringa, 2003)
Linker propensity from 2-linker dataset (George-Heringa, 2003)
Linker propensity from 3-linker dataset (George-Heringa, 2003)
Linker propensity from small dataset (linker length is less than six residues) (George-Heringa, 2003)
Linker propensity from medium dataset (linker length is between six and 14 residues) (George-Heringa, 2003)
Linker propensity from long dataset (linker length is greater than 14 residues) (George-Heringa, 2003)
Linker propensity from helical (annotated by DSSP) dataset (George-Heringa, 2003)
Linker propensity from non-helical (annotated by DSSP) dataset (George-Heringa, 2003)
The stability scale from the knowledge-based atom-atom potential (Zhou-Zhou, 2004)
The relative stability scale extracted from mutation experiments (Zhou-Zhou, 2004)
Buriability (Zhou-Zhou, 2004)
Linker index (Bae et al., 2005)
Mean volumes of residues buried in protein interiors (Harpaz et al., 1994)
Average volumes of residues (Pontius et al., 1996)
Hydrostatic pressure asymmetry index, PAI (Di Giulio, 2005)
Hydrophobicity index (Wolfenden et al., 1979)
Average internal preferences (Olsen, 1980)
Hydrophobicity-related index (Kidera et al., 1985)
Apparent partition energies calculated from Wertz-Scheraga index (Guy, 1985)
Apparent partition energies calculated from Robson-Osguthorpe index (Guy, 1985)
Apparent partition energies calculated from Janin index (Guy, 1985)
Apparent partition energies calculated from Chothia index (Guy, 1985)
Hydropathies of amino acid side chains, neutral form (Roseman, 1988)
Hydropathies of amino acid side chains, pi-values in pH 7.0 (Roseman, 1988)
Weights from the IFH scale (Jacobs-White, 1989)
Hydrophobicity index, 3.0 pH (Cowan-Whittaker, 1990)
Scaled side chain hydrophobicity values (Black-Mould, 1991)
Hydrophobicity scale from native protein structures (Casari-Sippl, 1992)
NNEIG index (Cornette et al., 1987)
SWEIG index (Cornette et al., 1987)
PRIFT index (Cornette et al., 1987)
PRILS index (Cornette et al., 1987)
ALTFT index (Cornette et al., 1987)
ALTLS index (Cornette et al., 1987)
TOTFT index (Cornette et al., 1987)
TOTLS index (Cornette et al., 1987)
Relative partition energies derived by the Bethe approximation (Miyazawa-Jernigan, 1999)
Optimized relative partition energies - method A (Miyazawa-Jernigan, 1999)
Optimized relative partition energies - method B (Miyazawa-Jernigan, 1999)
Optimized relative partition energies - method C (Miyazawa-Jernigan, 1999)
Optimized relative partition energies - method D (Miyazawa-Jernigan, 1999)
Hydrophobicity index (Engelman et al., 1986)
Hydrophobicity index (Fasman, 1989)
https://www.genome.jp/aaindex/
From the original aaindex documentation:
Please cite the following references when making use of the database:
Kawashima, S. and Kanehisa, M. (2000) AAindex: amino acid index
database. Nucleic Acids Res., 28:374.
Tomii, K. and Kanehisa, M. (1996) Analysis of amino acid indices and
mutation matrices for sequence comparison and structure
prediction of proteins. Protein Eng., 9:27-36.
Nakai, K., Kidera, A., and Kanehisa, M. (1988) Cluster analysis of
amino acid indices for prediction of protein structure and
function. Protein Eng. 2:93-100.
# # Load data: # data(aaindex) # # Supose that we need the Kyte & Doolittle Hydrophaty index. We first look # at the entries with Kyte as author: # which(sapply(aaindex, function(x) length(grep("Kyte", x$A)) != 0)) # # This should return that entry number 151 named KYTJ820101 is the only # one that fit our request. We can access to it by position or by name, # for instance: # aaindex[[151]]$I aaindex[["KYTJ820101"]]$I aaindex$KYTJ820101$I# # Load data: # data(aaindex) # # Supose that we need the Kyte & Doolittle Hydrophaty index. We first look # at the entries with Kyte as author: # which(sapply(aaindex, function(x) length(grep("Kyte", x$A)) != 0)) # # This should return that entry number 151 named KYTJ820101 is the only # one that fit our request. We can access to it by position or by name, # for instance: # aaindex[[151]]$I aaindex[["KYTJ820101"]]$I aaindex$KYTJ820101$I
Returns simple protein sequence information including the number of residues, the percentage physico-chemical classes and the theoretical isoelectric point. The functions ignore ambiguous amino acids (e.g. "B", "Z", "X", "J").
AAstat(seq, plot = TRUE)AAstat(seq, plot = TRUE)
seq |
a protein sequence as a vector of upper-case chars |
plot |
if |
A list with the three following components:
Compo |
A factor giving the amino acid counts. |
Prop |
A list giving the percentage of each physico-chemical classes (Tiny, Small, Aliphatic, Aromatic, Non-polar, Polar, Charged, Positive, Negative). |
Pi |
The theoretical isoelectric point |
D. Charif, J.R. Lobry
citation("seqinr")
computePI, SEQINR.UTIL, SeqFastaAA
seqAA <- read.fasta(file = system.file("sequences/seqAA.fasta", package = "seqinr"), seqtype = "AA") AAstat(seqAA[[1]])seqAA <- read.fasta(file = system.file("sequences/seqAA.fasta", package = "seqinr"), seqtype = "AA") AAstat(seqAA[[1]])
These are low level functions to start and stop a remote access to an ACNUC database.
acnucopen(db, socket, challenge = NA) acnucclose(socket) clientid(id = paste("seqinr_", packageDescription("seqinr")$Version, sep = ""), socket, verbose = FALSE) quitacnuc(socket)acnucopen(db, socket, challenge = NA) acnucclose(socket) clientid(id = paste("seqinr_", packageDescription("seqinr")$Version, sep = ""), socket, verbose = FALSE) quitacnuc(socket)
db |
the remote ACNUC database name |
socket |
an object of class |
challenge |
unimplemented yet |
id |
client ID definition defaulting to seqinr + package version number |
verbose |
logical, if TRUE mode verbose is on |
these low level functions are usually not used directly by the user.
Use choosebank to open a remote ACNUC database
and closebank to close it.
For openacnuc a list with the following
components: type : the type of database that was opened.
totseqs, totspec, totkey : total number of seqs, species, keywords in opened database.
ACC_LENGTH, L_MNEMO, WIDTH_KW, WIDTH_SP, WIDTH_SMJ, WIDTH_AUT,
WIDTH_BIB, lrtxt, SUBINLNG: max lengths of record keys in database.
J.R. Lobry
citation("seqinr")
## Not run: # Need internet connection mysocket <- socketConnection( host = "pbil.univ-lyon1.fr", port = 5558, server = FALSE, blocking = TRUE) readLines(mysocket, n = 1) # OK acnuc socket started acnucopen("emblTP", socket = mysocket) -> res expected <- c("EMBL", "14138095", "236401", "1186228", "8", "16", "40", "40", "20", "20", "40", "60", "504") stopifnot(all(unlist(res) == expected)) tryalreadyopen <- try(acnucopen("emblTP", socket = mysocket)) stopifnot(inherits(tryalreadyopen, "try-error")) # Need a fresh socket because acnucopen() close it if error: mysocket <- socketConnection( host = "pbil.univ-lyon1.fr", port = 5558, server = FALSE, blocking = TRUE) tryoff <- try(acnucopen("off", socket = mysocket)) stopifnot(inherits(tryoff, "try-error")) mysocket <- socketConnection( host = "pbil.univ-lyon1.fr", port = 5558, server = FALSE, blocking = TRUE) tryinexistent <- try(acnucopen("tagadatagadatsointsoin", socket = mysocket)) stopifnot(inherits(tryinexistent, "try-error")) mysocket <- socketConnection( host = "pbil.univ-lyon1.fr", port = 5558, server = FALSE, blocking = TRUE) trycloseunopened <- try(acnucclose(mysocket)) stopifnot(inherits(trycloseunopened, "try-error")) ## End(Not run)## Not run: # Need internet connection mysocket <- socketConnection( host = "pbil.univ-lyon1.fr", port = 5558, server = FALSE, blocking = TRUE) readLines(mysocket, n = 1) # OK acnuc socket started acnucopen("emblTP", socket = mysocket) -> res expected <- c("EMBL", "14138095", "236401", "1186228", "8", "16", "40", "40", "20", "20", "40", "60", "504") stopifnot(all(unlist(res) == expected)) tryalreadyopen <- try(acnucopen("emblTP", socket = mysocket)) stopifnot(inherits(tryalreadyopen, "try-error")) # Need a fresh socket because acnucopen() close it if error: mysocket <- socketConnection( host = "pbil.univ-lyon1.fr", port = 5558, server = FALSE, blocking = TRUE) tryoff <- try(acnucopen("off", socket = mysocket)) stopifnot(inherits(tryoff, "try-error")) mysocket <- socketConnection( host = "pbil.univ-lyon1.fr", port = 5558, server = FALSE, blocking = TRUE) tryinexistent <- try(acnucopen("tagadatagadatsointsoin", socket = mysocket)) stopifnot(inherits(tryinexistent, "try-error")) mysocket <- socketConnection( host = "pbil.univ-lyon1.fr", port = 5558, server = FALSE, blocking = TRUE) trycloseunopened <- try(acnucclose(mysocket)) stopifnot(inherits(trycloseunopened, "try-error")) ## End(Not run)
Conventions used to name forensic microsatellite alleles (STR) are described in Bar et al. (1994). The name "9.3" means for instance that there are 9 repetitions of the complete base oligomer and an incomplete repeat with 3 bp.
al2bp(allele.name, repeat.bp = 4, offLadderChars = "><", split = "\\.")al2bp(allele.name, repeat.bp = 4, offLadderChars = "><", split = "\\.")
allele.name |
The name of the allele, coerced to a string type. |
repeat.bp |
The length in bp of the microsatellite base repeat, most of them are tetranucleotides so that it defaults to 4. Do not forget to change this to 5 for loci based on pentanucleotides such as Penta D or Penta E. |
offLadderChars |
|
split |
The convention is to use a dot, as in "9.3", between the number of repeats
and the number of bases in the incomplete repeat. On some locales where the
decimal separator is a comma this could be a source of problem, try to use
"," instead for this argument which is forwarded to |
Warnings generated by faulty numeric conversions are suppressed here.
A single numeric value corresponding to the size in bp of the allele, or NA when characters spoting off ladder alleles are encountedred or when numeric conversion is impossible (e.g. with "X" or "Y" allele names at Amelogenin locus).
J.R. Lobry
Bar, W. and Brinkmann, B. and Lincoln, P. and Mayr, W.R. and Rossi, U. (1994) DNA recommendations. 1994 report concerning further recommendations of the DNA Commission of the ISFH regarding PCR-based polymorphisms in STR (short tandem repeat) systems. Int. J. Leg. Med., 107:159-160.
citation("seqinR")
identifiler for forensic microsatellite allele name examples.
# # Quality check and examples: # stopifnot( al2bp("9") == 36 ) # 9 repeats of a tetranucleotide is 36 bp stopifnot( al2bp(9) == 36 ) # also OK with numerical argument stopifnot( al2bp(9, 5) == 45 ) # 9 repeats of a pentanucleotide is 45 bp stopifnot( al2bp("9.3") == 39 ) # microvariant case stopifnot( is.na(al2bp("<8")) ) # off ladder case stopifnot( is.na(al2bp(">19")) ) # off ladder case stopifnot( is.na(al2bp("X")) ) # non STR case # # Application to the alleles names in the identifiler data set where all loci are # tetranucleotide repeats: # data(identifiler) al.names <- unlist(identifiler) al.length <- sapply(al.names, al2bp) loc.names <- unlist(lapply(identifiler, names)) loc.nall <-unlist(lapply(identifiler, function(x) lapply(x,length))) loc.fac <- factor(rep(loc.names, loc.nall)) par(lend = "butt", mar = c(5,6,4,1)+0.1) boxplot(al.length~loc.fac, las = 1, col = "lightblue", horizontal = TRUE, main = "Range of allele lengths at forensic loci", xlab = "Length (bp)", ylim = c(0, max(al.length, na.rm = TRUE)))# # Quality check and examples: # stopifnot( al2bp("9") == 36 ) # 9 repeats of a tetranucleotide is 36 bp stopifnot( al2bp(9) == 36 ) # also OK with numerical argument stopifnot( al2bp(9, 5) == 45 ) # 9 repeats of a pentanucleotide is 45 bp stopifnot( al2bp("9.3") == 39 ) # microvariant case stopifnot( is.na(al2bp("<8")) ) # off ladder case stopifnot( is.na(al2bp(">19")) ) # off ladder case stopifnot( is.na(al2bp("X")) ) # non STR case # # Application to the alleles names in the identifiler data set where all loci are # tetranucleotide repeats: # data(identifiler) al.names <- unlist(identifiler) al.length <- sapply(al.names, al2bp) loc.names <- unlist(lapply(identifiler, names)) loc.nall <-unlist(lapply(identifiler, function(x) lapply(x,length))) loc.fac <- factor(rep(loc.names, loc.nall)) par(lend = "butt", mar = c(5,6,4,1)+0.1) boxplot(al.length~loc.fac, las = 1, col = "lightblue", horizontal = TRUE, main = "Range of allele lengths at forensic loci", xlab = "Length (bp)", ylim = c(0, max(al.length, na.rm = TRUE)))
This is a low level function to get the total number of list and all their ranks in an opened database.
alllistranks(socket = autosocket(), verbose = FALSE) alr(socket = autosocket(), verbose = FALSE)alllistranks(socket = autosocket(), verbose = FALSE) alr(socket = autosocket(), verbose = FALSE)
socket |
an object of class |
verbose |
if |
This low level function is usually not used directly by the user.
A list with two components:
count |
count of existing lists |
rank |
their rank |
J.R. Lobry
citation("seqinr")
## Not run: # Need internet connection choosebank("emblTP") tmp1 <- query("tmp1", "sp=Borrelia burgdorferi", virtual = TRUE) tmp2 <- query("tmp2", "sp=Borrelia burgdorferi", virtual = TRUE) tmp3 <- query("tmp3", "sp=Borrelia burgdorferi", virtual = TRUE) (result <- alllistranks()) stopifnot(result$count == 3) # Three ACNUC lists stopifnot(result$ranks == 2:4) # Starting at rank 2 # # Summay of current lists defined on the ACNUC server: # sapply(result$ranks, getliststate) closebank() ## End(Not run)## Not run: # Need internet connection choosebank("emblTP") tmp1 <- query("tmp1", "sp=Borrelia burgdorferi", virtual = TRUE) tmp2 <- query("tmp2", "sp=Borrelia burgdorferi", virtual = TRUE) tmp3 <- query("tmp3", "sp=Borrelia burgdorferi", virtual = TRUE) (result <- alllistranks()) stopifnot(result$count == 3) # Three ACNUC lists stopifnot(result$ranks == 2:4) # Starting at rank 2 # # Summay of current lists defined on the ACNUC server: # sapply(result$ranks, getliststate) closebank() ## End(Not run)
This function returns the list of nucleotide matching a given IUPAC
nucleotide symbol, for instance c("c", "g") for "s".
amb(base, forceToLower = TRUE, checkBase = TRUE, IUPAC = s2c("acgturymkswbdhvn"), u2t = TRUE)amb(base, forceToLower = TRUE, checkBase = TRUE, IUPAC = s2c("acgturymkswbdhvn"), u2t = TRUE)
base |
an IUPAC symbol for a nucleotide as a single character |
forceToLower |
if TRUE the base is forced to lower case |
checkBase |
if TRUE the character is checked to belong to the allowed IUPAC symbol list |
IUPAC |
the list of allowed IUPAC symbols |
u2t |
if TRUE "u" for uracil in RNA are changed into "t" for thymine in DNA |
Non ambiguous bases are returned unchanged (except for "u" when u2t is TRUE).
When base is missing, the list of IUPAC symbols is returned, otherwise a vector with expanded symbols.
J.R. Lobry
The nomenclature for incompletely specified bases in nucleic acid sequences at: https://pmc.ncbi.nlm.nih.gov/articles/PMC341218/
citation("seqinr")
See bma for the reverse operation.
Use tolower to change upper case letters into
lower case letters.
# # The list of IUPAC symbols: # amb() # # And their expansion: # sapply(amb(), amb)# # The list of IUPAC symbols: # amb() # # And their expansion: # sapply(amb(), amb)
This data set is what should be obtained when runing kaks()
on the test file Anouk.fasta in the sequences directory of the
seqinR package.
data(AnoukResult)data(AnoukResult)
A list with 4 components of class dist.
Ka
Ks
variance for Ka
variance for Ks
See the example in kaks.
The fasta test file was provided by Anamaria Necşulea.
citation("seqinr")
Returns an object of (S3) class alignment.
as.alignment(nb = NULL, nam = NULL, seq = NULL, com = NULL)as.alignment(nb = NULL, nam = NULL, seq = NULL, com = NULL)
nb |
integer. The number of sequences in the alignment. |
nam |
vector of |
seq |
vector of |
com |
vector of |
An object of class alignment which is a list with the following components:
nb |
the number of aligned sequences |
nam |
a vector of strings containing the names of the aligned sequences |
seq |
a vector of strings containing the aligned sequences |
com |
a vector of strings containing the commentaries for each sequence or |
D. Charif, J.R. Lobry
citation("seqinr")
read.alignment,
as.matrix.alignment, read.fasta,
write.fasta, reverse.align, dist.alignment.
as.alignment(nb = 2, nam = c("one", "two"), seq = c("-ACGT", "GACG-"), com = c("un", "deux"))as.alignment(nb = 2, nam = c("one", "two"), seq = c("-ACGT", "GACG-"), com = c("un", "deux"))
Converts an alignment into a matrix of characters
## S3 method for class 'alignment' as.matrix(x, ...)## S3 method for class 'alignment' as.matrix(x, ...)
x |
an object of the class alignment. |
... |
additional arguments to be passed to or from methods. |
A matrix of characters.
J.R. Lobry
phylip <- read.alignment(file = system.file("sequences/test.phylip", package = "seqinr"), format = "phylip") as.matrix(phylip)phylip <- read.alignment(file = system.file("sequences/test.phylip", package = "seqinr"), format = "phylip") as.matrix(phylip)
This is a low level function that is mainly used to select automatically the last opened ACNUC database for functions using sockets.
autosocket()autosocket()
An object of class sockconn.
J.R. Lobry
https://doua.prabi.fr/databases/acnuc.html
citation("seqinr")
## Not run: #Need internet connection choosebank("emblTP") autosocket() closebank() ## End(Not run)## Not run: #Need internet connection choosebank("emblTP") autosocket() closebank() ## End(Not run)
This function tries to estimate the baseline value for RFU data from capillary electrophoresis whith the heuristic that the most common value is the baseline.
baselineabif(rfu, maxrfu = 1000)baselineabif(rfu, maxrfu = 1000)
rfu |
a numeric vector of signal value |
maxrfu |
signal values greater or equal to maxrfu are forced to NA |
A single numeric value for the estimated baseline.
J.R. Lobry
JLO for a dataset example, plotabif to plot this kind of data,
peakabif to estimate peak parameters.
data(JLO) rfu <- JLO$Data$DATA.1 bl <- baselineabif(rfu) plot(1:length(rfu), rfu, type = "l", xlab = "Time [datapoint units]", ylab = "Signal [RFU]", main = "Example of baseline estimates") abline(h = bl, col="red", lty = 2) legend("topright", inset = 0.02, "Baseline estimate", lty = 2, col = "red")data(JLO) rfu <- JLO$Data$DATA.1 bl <- baselineabif(rfu) plot(1:length(rfu), rfu, type = "l", xlab = "Time [datapoint units]", ylab = "Signal [RFU]", main = "Example of baseline estimates") abline(h = bl, col="red", lty = 2) legend("topright", inset = 0.02, "Baseline estimate", lty = 2, col = "red")
This function returns the IUPAC symbol for a nucleotide sequence, for instance
c("c", "c", "g") is coded by "s".
bma(nucl, warn.non.IUPAC = TRUE, type = c("DNA", "RNA"))bma(nucl, warn.non.IUPAC = TRUE, type = c("DNA", "RNA"))
nucl |
a nucleotide sequence as a vector of single chars |
warn.non.IUPAC |
if TRUE warns when no IUPAC symbol is possible |
type |
whether this is a DNA or a RNA sequence |
The sequence is forced in lower case letters and ambiguous bases are expanded before trying to find an IUPAC symbol.
A single IUPAC symbol in lower case, or NA when this is not possible.
J.R. Lobry
The nomenclature for incompletely specified bases in nucleic acid sequences at: https://pmc.ncbi.nlm.nih.gov/articles/PMC341218/
citation("seqinr")
See amb for the reverse operation.
Use toupper to change lower case letters into
upper case letters.
stopifnot(bma(s2c("atatattttata")) == "w") stopifnot(bma(s2c("gcggcgcgcggc")) == "s") stopifnot(bma(s2c("ACGT")) == "n") stopifnot(is.na(bma(s2c("atatttt---tatat")))) # a warning is issuedstopifnot(bma(s2c("atatattttata")) == "w") stopifnot(bma(s2c("gcggcgcgcggc")) == "s") stopifnot(bma(s2c("ACGT")) == "n") stopifnot(is.na(bma(s2c("atatttt---tatat")))) # a warning is issued
This is a simple utility function to convert a vector of chars such as c("m", "e", "r", "g", "e", "d") into a single string such as "merged".
c2s(chars = c("m", "e", "r", "g", "e", "d"))c2s(chars = c("m", "e", "r", "g", "e", "d"))
chars |
a vector of chars |
a string
J.R. Lobry
citation("seqinr")
c2s( c("m","e","r","g","e","d") )c2s( c("m","e","r","g","e","d") )
The Codon Adaptation Index (Sharp and Li 1987) is the most popular
index of gene expressivity with about 1000 citations 20 years after its
publication. Its values range from 0 (low) to 1 (high). The implementation
here is intended to work exactly as in the program codonW written by
by John Peden during his PhD thesis under the supervision of P.M. Sharp.
cai(seq, w, numcode = 1, zero.threshold = 0.0001, zero.to = 0.01)cai(seq, w, numcode = 1, zero.threshold = 0.0001, zero.to = 0.01)
seq |
a coding sequence as a vector of single characters |
w |
a vector for the relative adaptiveness of each codon |
numcode |
the genetic code number as in |
zero.threshold |
a value in |
zero.to |
a value considered as zero in |
Adapted from the documentation of the CAI function in the
program codonW writen by John Peden:
CAI is a measurement
of the relative adaptiveness of the codon usage of a gene towards the
codon usage of highly expressed genes. The relative adaptiveness (w) of
each codon is the ratio of the usage of each codon, to that of the most
abundant codon for the same amino acid. The CAI
index is defined as the geometric mean of these relative adaptiveness
values. Non-synonymous codons and termination codons (genetic code
dependent) are excluded. To aid computation, the CAI is calculated as
using a natural log summation, To prevent a codon having a relative
adaptiveness value of zero, which could result in a CAI of zero;
these codons have fitness of zero (<.0001) are adjusted to 0.01.
A single numerical value for the CAI.
J.R. Lobry
Sharp, P.M., Li, W.-H. (1987) The codon adaptation index - a measure of directional synonymous codon usage bias, and its potential applications. Nucleic Acids Research, 15:1281-1295.
Bulmer, M. (1988). Are codon usage patterns in unicellular organisms determined by selection-mutation balance. Journal of Evolutionary Biology, 1:15-26.
Peden, J.F. (1999) Analysis of codon usage. PhD Thesis, University of Nottingham, UK.
The program codonW used here for comparison is available at
https://codonw.sourceforge.net/ under a GPL licence.
citation("seqinr").
caitab for some w values from codonW.
uco for codon usage tabulation.
# # How to reproduce the results obtained with the C program codonW # version 1.4.4 writen by John Peden. We use here the "input.dat" # test file from codonW (Saccharomyces cerevisiae). # inputdatfile <- system.file("sequences/input.dat", package = "seqinr") input <- read.fasta(file = inputdatfile) # read the FASTA file # # Import results obtained with codonW # scucofile <- system.file("sequences/scuco.txt", package = "seqinr") scuco.res <- read.table(scucofile, header = TRUE) # read codonW result file # # Use w for Saccharomyces cerevisiae # data(caitab) w <- caitab$sc # # Compute CAI and compare results: # cai.res <- sapply(input, cai, w = w) plot(cai.res, scuco.res$CAI, main = "Comparison of seqinR and codonW results", xlab = "CAI from seqinR", ylab = "CAI from codonW", las = 1) abline(c(0,1))# # How to reproduce the results obtained with the C program codonW # version 1.4.4 writen by John Peden. We use here the "input.dat" # test file from codonW (Saccharomyces cerevisiae). # inputdatfile <- system.file("sequences/input.dat", package = "seqinr") input <- read.fasta(file = inputdatfile) # read the FASTA file # # Import results obtained with codonW # scucofile <- system.file("sequences/scuco.txt", package = "seqinr") scuco.res <- read.table(scucofile, header = TRUE) # read codonW result file # # Use w for Saccharomyces cerevisiae # data(caitab) w <- caitab$sc # # Compute CAI and compare results: # cai.res <- sapply(input, cai, w = w) plot(cai.res, scuco.res$CAI, main = "Comparison of seqinR and codonW results", xlab = "CAI from seqinR", ylab = "CAI from codonW", las = 1) abline(c(0,1))
Information about a preferred set of codons for highly expressed genes in three species.
data(caitab)data(caitab)
A data frame with 64 rows for the codons and the following 3 columns:
Escherichia coli
Bacillus subtilis
Saccharomyces cerevisiae
Codons are given by row.names(caitab).
The data were hard-encoded in
the C program codonW version 1.4.4 writen by John Peden
available at https://codonw.sourceforge.net/. The data
are from the file codonW.h.
According to this source file, there were no reference for
Escherichia coli and Bacillus subtilis and the
reference for Saccharomyces cerevisiae was Sharp
and Cowe (1991).
It turns out that the data for Escherichia coli and Saccharomyces cerevisiae are identical to table 1 in Sharp and Li (1987) where the missing values for the stop codons are represented here by zeros. All codons were documented by at least one count in both datasets.
The data for Bacillus subtilis are from table 2 in Shields
and Sharp (1987). Missing values for stops codons are represented
as previously by zeros, missing values for single-box amino-acids
are represented by 1 here. Note that some codons were undocumented
in this dataset and that a 0.5 value in absolute frequencies was
already forced to avoid zeros. It is therefore impossible to use
directly these data to obtain the exact expected CAI values as documented
in cai because of overlapping with documented codons.
Sharp, P.M., Li, W.-H. (1987) The codon adaptation index - a measure of directional synonymous codon usage bias, and its potential applications. Nucleic Acids Research, 15:1281-1295.
Shields, D.C., Sharp, P.M. (1987) Synonymous codon usage in Bacillus subtilis reflects both traditional selection and mutational biases. Nucleic Acids Research, 15:8023-8040.
Sharp, P. M., Cowe, E. (1991). Synonymous codon usage in Saccharomyces cerevisiae. Yeast, 7:657-678.
Peden, J.F. (1999) Analysis of codon usage. PhD Thesis, University of Nottingham, UK.
citation("seqinr")
cai for an example using this dataset to compute CAI values.
data(caitab)data(caitab)
Long before the genomic era, it was possible to get some data for the global composition of single-stranded DNA chromosomes by direct chemical analyses. These data are from Chargaff's lab and give the base composition of the L (Ligth) strand for 7 bacterial chromosomes.
data(chargaff)data(chargaff)
A data frame with 7 observations on the following 4 variables.
frequencies of A bases in percent
frequencies of G bases in percent
frequencies of C bases in percent
frequencies of T bases in percent
Data are from Table 2 in Rudner et al. (1969) for the
L-strand. Data for Bacillus subtilis were taken from
a previous paper: Rudner et al. (1968). This is in
fact the average value observed for two different strains
of B. subtilis: strain W23 and strain Mu8u5u16.
Denaturated chromosomes can be separated by a technique of
intermitent gradient elution from a column of methylated
albumin kieselguhr (MAK), into two fractions, designated,
by virtue of their buoyant densities, as L (light) and H
(heavy). The fractions can be hydrolyzed and subjected to
chromatography to determined their global base composition.
The surprising result is that we have almost exactly A=T
and C=G in single stranded-DNAs. The second paragraph page
157 in Rudner et al. (1969) says: "Our previous
work on the complementary strands of B. subtilis DNA
suggested an additional, entirely unexpected regularity,
namely, the equality in either strand of 6-amino and 6-keto
nucleotides ( A + C = G + T). This relationship, which
would normally have been regarded merely as the consequence
of base-pairing in DNA duplex and would not have been predicted
as a likely property of a single strand, is shown here to
apply to all strand specimens isolated from denaturated DNA
of the AT type (Table 2, preps. 1-4). It cannot yet be said
to be established for the DNA specimens from the equimolar
and GC types (nos. 5-7)."
Try example(chargaff) to mimic figure page 17 in Lobry
(2000) :
Note that example(chargaff) gives more details:
the red areas correspond to non-allowed values beause the sum
of the four bases frequencies cannot exceed 100%.
The white areas correspond to possible values (more exactly
to the projection from R^4 to the corresponding R^2 planes
of the region of allowed values).
The blue lines correspond to the very small subset of allowed
values for which we have in addition PR2 state, that is
[A]=[T] and [C]=[G]. Remember, these data are for ssDNA!
Rudner, R., Karkas, J.D., Chargaff, E. (1968) Separation of
B. subtilis DNA into complementary strands, III. Direct
Analysis. Proceedings of the National Academy of Sciences of the United States of America, 60:921-922.
Rudner, R., Karkas, J.D., Chargaff, E. (1969) Separation of microbial deoxyribonucleic acids into complementary strands. Proceedings of the National Academy of Sciences of the United States of America, 63:152-159.
Lobry, J.R. (2000) The black hole of symmetric molecular evolution. Habilitation thesis, Université Claude Bernard - Lyon 1. https://pbil.univ-lyon1.fr/members/lobry/articles/HDR.pdf.
citation("seqinr")
data(chargaff) op <- par(no.readonly = TRUE) par(mfrow = c(4,4), mai = rep(0,4), xaxs = "i", yaxs = "i") xlim <- ylim <- c(0, 100) for( i in 1:4 ) { for( j in 1:4 ) { if( i == j ) { plot(chargaff[,i], chargaff[,j],t = "n", xlim = xlim, ylim = ylim, xlab = "", ylab = "", xaxt = "n", yaxt = "n") polygon(x = c(0, 0, 100, 100), y = c(0, 100, 100, 0), col = "lightgrey") for( k in seq(from = 0, to = 100, by = 10) ) { lseg <- 3 segments(k, 0, k, lseg) segments(k, 100 - lseg, k, 100) segments(0, k, lseg, k) segments(100 - lseg, k, 100, k) } string <- paste(names(chargaff)[i],"\n\n",xlim[1],"% -",xlim[2],"%") text(x=mean(xlim),y=mean(ylim), string, cex = 1.5) } else { plot(chargaff[,i], chargaff[,j], pch = 1, xlim = xlim, ylim = ylim, xlab = "", ylab = "", xaxt = "n", yaxt = "n", cex = 2) iname <- names(chargaff)[i] jname <- names(chargaff)[j] direct <- function() segments(0, 0, 50, 50, col="blue") invers <- function() segments(0, 50, 50, 0, col="blue") PR2 <- function() { if( iname == "[A]" & jname == "[T]" ) { direct(); return() } if( iname == "[T]" & jname == "[A]" ) { direct(); return() } if( iname == "[C]" & jname == "[G]" ) { direct(); return() } if( iname == "[G]" & jname == "[C]" ) { direct(); return() } invers() } PR2() polygon(x = c(0, 100, 100), y = c(100, 100, 0), col = "pink4") polygon(x = c(0, 0, 100), y = c(0, 100, 0)) } } } # Clean up par(op)data(chargaff) op <- par(no.readonly = TRUE) par(mfrow = c(4,4), mai = rep(0,4), xaxs = "i", yaxs = "i") xlim <- ylim <- c(0, 100) for( i in 1:4 ) { for( j in 1:4 ) { if( i == j ) { plot(chargaff[,i], chargaff[,j],t = "n", xlim = xlim, ylim = ylim, xlab = "", ylab = "", xaxt = "n", yaxt = "n") polygon(x = c(0, 0, 100, 100), y = c(0, 100, 100, 0), col = "lightgrey") for( k in seq(from = 0, to = 100, by = 10) ) { lseg <- 3 segments(k, 0, k, lseg) segments(k, 100 - lseg, k, 100) segments(0, k, lseg, k) segments(100 - lseg, k, 100, k) } string <- paste(names(chargaff)[i],"\n\n",xlim[1],"% -",xlim[2],"%") text(x=mean(xlim),y=mean(ylim), string, cex = 1.5) } else { plot(chargaff[,i], chargaff[,j], pch = 1, xlim = xlim, ylim = ylim, xlab = "", ylab = "", xaxt = "n", yaxt = "n", cex = 2) iname <- names(chargaff)[i] jname <- names(chargaff)[j] direct <- function() segments(0, 0, 50, 50, col="blue") invers <- function() segments(0, 50, 50, 0, col="blue") PR2 <- function() { if( iname == "[A]" & jname == "[T]" ) { direct(); return() } if( iname == "[T]" & jname == "[A]" ) { direct(); return() } if( iname == "[C]" & jname == "[G]" ) { direct(); return() } if( iname == "[G]" & jname == "[C]" ) { direct(); return() } invers() } PR2() polygon(x = c(0, 100, 100), y = c(100, 100, 0), col = "pink4") polygon(x = c(0, 0, 100), y = c(0, 100, 0)) } } } # Clean up par(op)
This function allows to select one of the databases structured under ACNUC and located on the web.
Called without arguments, choosebank(), will return the list of available databases.
Then, you can use query to make your query and get a list of sequence names.
Remote access to ACNUC databases works by opening a socket connection on a port (for example
on port number 5558 at pbil.univ-lyon1.fr) and by communicating on this socket following the protocol
described in the section references.
choosebank(bank = NA, host = "pbil.univ-lyon1.fr", port = 5558, server = FALSE, blocking = TRUE, open = "a+", encoding = "", verbose = FALSE, timeout = 5, infobank = FALSE, tagbank = NA)choosebank(bank = NA, host = "pbil.univ-lyon1.fr", port = 5558, server = FALSE, blocking = TRUE, open = "a+", encoding = "", verbose = FALSE, timeout = 5, infobank = FALSE, tagbank = NA)
bank |
string. The name of the bank. If NA, |
host |
string. Host name for port (see |
port |
integer. The TCP port number (see |
server |
logical. Should the socket be a client or a server? (see |
blocking |
logical. (see |
open |
string. A description of how to open the connection (see |
encoding |
string. The name of the encoding to be used. (see |
verbose |
logical. If TRUE, verbose mode is on |
timeout |
integer. The timeout in seconds for |
infobank |
logical. If |
tagbank |
string. If |
When called without arguments, choosebank() returns a list of all the databases names known
by the server, as a vector of string. When called with choosebank(infobank = TRUE), a data.frame
with more information is returned.The environment .seqinrEnv is used to save several variables
such as socket and sequence list.
When called with a regular bank name, an (invisible) list with 6 components:
socket |
an object of class |
bankname |
the name of the bank |
banktype |
the type of the bank (GENBANK, EMBL, SWISSPROT, NBRF) |
totseqs |
the total number of sequences present in the opened database |
totspecs |
the total number of species present in the opened database |
totkeys |
the total number of keywords present in the opened database |
When called with bank = NA:
names |
A vector of all available bank names. |
When called with bank = NA and infobank = TRUE, a data.frame with three columns:
bank |
The name of the bank. |
status |
The bank status (on/of). |
info |
Short description of bank with last release date. |
The invisible list returned when a database is opened is stored in the variable
banknameSocket in the global environment.
D. Charif, J.R. Lobry
For more information about the socket communication protocol with ACNUC please get at https://doua.prabi.fr/databases/acnuc/remote_acnuc.html.
Gouy, M., Milleret, F., Mugnier, C., Jacobzone, M., Gautier,C. (1984) ACNUC: a nucleic acid sequence data base and analysis system.
Nucl. Acids Res., 12:121-127.
Gouy, M., Gautier, C., Attimonelli, M., Lanave, C., Di Paola, G. (1985)
ACNUC - a portable retrieval system for nucleic acid sequence databases:
logical and physical designs and usage.
Comput. Appl. Biosci., 3:167-172.
Gouy, M., Gautier, C., Milleret, F. (1985) System analysis and nucleic acid sequence banks.
Biochimie, 67:433-436.
citation("seqinr")
where.is.this.acc if you have a sequence accession number but you
don't know which database to open, query to make a query when a database
is opened, connection, socketConnection
## Not run: # Need internet connection # Show available databases: choosebank() # Show frozen databases: choosebank(tag = "TP") # Select a database: choosebank("emblTP", tag = "TP") # Do something with the database: myseq <- gfrag("LMFLCHR36", start = 1, length = 30) stopifnot(myseq == "cgcgtgctggcggcaatgaagcgttcgatg") # Close the database: closebank() ## End(Not run)## Not run: # Need internet connection # Show available databases: choosebank() # Show frozen databases: choosebank(tag = "TP") # Select a database: choosebank("emblTP", tag = "TP") # Do something with the database: myseq <- gfrag("LMFLCHR36", start = 1, length = 30) stopifnot(myseq == "cgcgtgctggcggcaatgaagcgttcgatg") # Close the database: closebank() ## End(Not run)
Draws a circle or an arc-circle on the current graphic device
circle(x = 0, y = 0, r = 1, theta = c(0, 360), n = 100, ...)circle(x = 0, y = 0, r = 1, theta = c(0, 360), n = 100, ...)
x |
x coordinate for the center of the circle |
y |
y coordinate for the center of the circle |
r |
radius of the circle |
theta |
start and stop angle |
n |
number of points for polygon object |
... |
arguments passed to |
none
J.R. Lobry
par(mfrow = c(2, 2), mar = c(0,0,2,0)) setup <- function(){ plot.new() plot.window(xlim = c(-1,1), ylim = c(-1,1), asp = 1) } setup() circle(col = "lightblue") title(main = "theta = c(0, 360)") setup() circle(col = "lightblue", theta = c(0, 270)) title(main = "theta = c(0, 270)") setup() circle(col = "lightblue", theta = c(-90, 180)) title(main = "theta = c(-90, 180)") setup() n <- 20 for(i in seq(0, 360, length = n)){ circle(col = "lightblue", theta = c(i, i+360/(2*n))) } title(main = "many thetas")par(mfrow = c(2, 2), mar = c(0,0,2,0)) setup <- function(){ plot.new() plot.window(xlim = c(-1,1), ylim = c(-1,1), asp = 1) } setup() circle(col = "lightblue") title(main = "theta = c(0, 360)") setup() circle(col = "lightblue", theta = c(0, 270)) title(main = "theta = c(0, 270)") setup() circle(col = "lightblue", theta = c(-90, 180)) title(main = "theta = c(-90, 180)") setup() n <- 20 for(i in seq(0, 360, length = n)){ circle(col = "lightblue", theta = c(i, i+360/(2*n))) } title(main = "many thetas")
This function tries to close a remote ACNUC database.
closebank(socket = autosocket(), verbose = FALSE)closebank(socket = autosocket(), verbose = FALSE)
socket |
an object of class |
verbose |
Logical. If TRUE, verbose mode is on |
J.R. Lobry
citation("seqinr")
## Not run: # Need internet connection choosebank("emblTP") closebank() ## End(Not run)## Not run: # Need internet connection choosebank("emblTP") closebank() ## End(Not run)
This data set gives an example of a protein alignment obtained after a call to the function read.alignment on an alignment file in "clustal" format.
data(clustal)data(clustal)
A List of class alignment
http://www.clustal.org/
Thompson, J.D., Higgins D.G., Gibson T.J. (1994) CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position specific gap penalties and weight matrix choice. Nucleic Acids Res. 22(22):4673-80.
Takes as input a standard R color and an alpha value to return its rgb coding.
col2alpha(color, alpha = 0.5)col2alpha(color, alpha = 0.5)
color |
A standard R color as in |
alpha |
An alpha transparency value in the interval [0,1]. |
same as in rgb.
J.R. Lobry
# # Need alpha transparency channel # par(mar = c(0, 0, 2, 2)+0.1, oma = c(0, 0, 2, 0), mfrow = c(3,2)) for(testcol in c("blue", "red", "green", "yellow", "purple", "darkgreen")){ plot(0,0, type="n", xlim=0:1, ylim = 0:1, axes = FALSE, xlab = "", ylab = "", main = testcol) n <- 11 for(i in seq(0, 1, length = n)){ col <- col2alpha(testcol, i) rect(i, 0, i + 1/n, 1, col = col, border = "black", xpd = NA) text(i+0.5/n, 0.5, round(i,2), xpd = NA) } } mtext("Effect of alpha on some colors\nNote: need alpha transparency channel", side = 3, outer = TRUE) # # The substractive color scheme: # par(mar = c(0,0,3,0)) plot.new() plot.window(xlim = c(-1.5, 1.5), ylim = c(-1,1.75), asp = 1) n <- 10 alpha <- 1/n for(i in 1:(2*n)){ circle(x = -0.5, y = 0, col = col2alpha("yellow", alpha)) circle(x = 0.5, y = 0, col = col2alpha("cyan", alpha)) circle(x = 0, y = 3/4, col = col2alpha("magenta", alpha)) } title("Substractive color scheme\nNote: need alpha transparency channel")# # Need alpha transparency channel # par(mar = c(0, 0, 2, 2)+0.1, oma = c(0, 0, 2, 0), mfrow = c(3,2)) for(testcol in c("blue", "red", "green", "yellow", "purple", "darkgreen")){ plot(0,0, type="n", xlim=0:1, ylim = 0:1, axes = FALSE, xlab = "", ylab = "", main = testcol) n <- 11 for(i in seq(0, 1, length = n)){ col <- col2alpha(testcol, i) rect(i, 0, i + 1/n, 1, col = col, border = "black", xpd = NA) text(i+0.5/n, 0.5, round(i,2), xpd = NA) } } mtext("Effect of alpha on some colors\nNote: need alpha transparency channel", side = 3, outer = TRUE) # # The substractive color scheme: # par(mar = c(0,0,3,0)) plot.new() plot.window(xlim = c(-1.5, 1.5), ylim = c(-1,1.75), asp = 1) n <- 10 alpha <- 1/n for(i in 1:(2*n)){ circle(x = -0.5, y = 0, col = col2alpha("yellow", alpha)) circle(x = 0.5, y = 0, col = col2alpha("cyan", alpha)) circle(x = 0, y = 3/4, col = col2alpha("magenta", alpha)) } title("Substractive color scheme\nNote: need alpha transparency channel")
Complements a sequence, for instance if the sequence is
"a","c","g","t" it returns "t","g","c","a".
This is not the reverse complementary strand. This function
can handle ambiguous bases if required.
comp(seq, forceToLower = TRUE, ambiguous = FALSE)comp(seq, forceToLower = TRUE, ambiguous = FALSE)
seq |
a DNA sequence as a vector of single chars |
forceToLower |
if TRUE characters in |
ambiguous |
if TRUE ambiguous bases in |
a vector of characters which is the complement of the sequence, not the reverse complementary strand. Undefined values are returned as NA.
D. Charif, J.R. Lobry
citation("seqinr")
Because ssDNA sequences are always written in the 5'->3'
direction, use rev(comp(seq)) to get the reverse complementary
strand (see rev).
## ## Show that comp() does *not* return the reverve complementary strand: ## c2s(comp(s2c("aaaattttggggcccc"))) ## ## Show how to get the reverse complementary strand: ## c2s(rev(comp(s2c("aaaattttggggcccc")))) ## ## Show what happens with non allowed values: ## c2s(rev(comp(s2c("aaaaXttttYggggZcccc")))) ## ## Show what happens with ambiguous bases: ## allbases <- s2c("abcdghkmstvwn") comp(allbases) # NA are produced comp(allbases, ambiguous = TRUE) # No more NA ## ## Routine sanity checks: ## stopifnot(identical(comp(allbases, ambiguous = TRUE), s2c("tvghcdmksabwn"))) stopifnot(identical(comp(c("A", "C", "G", "T"), forceToLower = FALSE), c("T", "G", "C", "A")))## ## Show that comp() does *not* return the reverve complementary strand: ## c2s(comp(s2c("aaaattttggggcccc"))) ## ## Show how to get the reverse complementary strand: ## c2s(rev(comp(s2c("aaaattttggggcccc")))) ## ## Show what happens with non allowed values: ## c2s(rev(comp(s2c("aaaaXttttYggggZcccc")))) ## ## Show what happens with ambiguous bases: ## allbases <- s2c("abcdghkmstvwn") comp(allbases) # NA are produced comp(allbases, ambiguous = TRUE) # No more NA ## ## Routine sanity checks: ## stopifnot(identical(comp(allbases, ambiguous = TRUE), s2c("tvghcdmksabwn"))) stopifnot(identical(comp(c("A", "C", "G", "T"), forceToLower = FALSE), c("T", "G", "C", "A")))
This function calculates the theoretical isoelectric point of a protein. Isoelectric point is the pH at which the protein has a neutral charge. This estimate does not account for the post-translational modifications.
computePI(seq)computePI(seq)
seq |
Protein sequence as a vector of single chars in upper case |
The theoretical isoelectric point (pI) as a numerical vector of length one.
Protein pI is calculated using pK values of amino acids described in Bjellqvist et al. See also SEQINR.UTIL for more details.
D. Charif, J.R. Lobry
The algorithm is the same as the one which is implemented at the following url:
https://web.expasy.org/compute_pi/pi_tool-doc.html but with many trials
in case of convergence failure of the non-linear regression procedure.
citation("seqinr")
# # Simple sanity check with all 20 amino-acids in one-letter code alphabetical order: # prot <- s2c("ACDEFGHIKLMNPQRSTVWY") stopifnot(all.equal(computePI(prot), 6.78454)) # # Read a protein sequence in a FASTA file and then compute its pI : # myProts <- read.fasta(file = system.file("sequences/seqAA.fasta", package = "seqinr"), seqtype = "AA") computePI(myProts[[1]]) # Should be 8.534902# # Simple sanity check with all 20 amino-acids in one-letter code alphabetical order: # prot <- s2c("ACDEFGHIKLMNPQRSTVWY") stopifnot(all.equal(computePI(prot), 6.78454)) # # Read a protein sequence in a FASTA file and then compute its pI : # myProts <- read.fasta(file = system.file("sequences/seqAA.fasta", package = "seqinr"), seqtype = "AA") computePI(myProts[[1]]) # Should be 8.534902
This function returns a consensus using variuous methods (see details) or a profile from a sequence alignment.
consensus(matali, method = c( "majority", "threshold", "IUPAC", "profile"), threshold = 0.60, warn.non.IUPAC = FALSE, threshold.IUPAC = FALSE, type = c("DNA", "RNA")) con(matali, method = c( "majority", "threshold", "IUPAC", "profile"), threshold = 0.60, warn.non.IUPAC = FALSE, threshold.IUPAC = FALSE, type = c("DNA", "RNA"))consensus(matali, method = c( "majority", "threshold", "IUPAC", "profile"), threshold = 0.60, warn.non.IUPAC = FALSE, threshold.IUPAC = FALSE, type = c("DNA", "RNA")) con(matali, method = c( "majority", "threshold", "IUPAC", "profile"), threshold = 0.60, warn.non.IUPAC = FALSE, threshold.IUPAC = FALSE, type = c("DNA", "RNA"))
matali |
an object of class |
method |
select the method to use, see details. |
threshold |
for the |
warn.non.IUPAC |
for the |
threshold.IUPAC |
with the |
type |
for the |
The character with the higher frequency is returned as the consensus character.
As above but in addition the character relative frequency
must be higher than the value controled by the threshold argument.
If none, NA is returned if threshold.IUPAC is set to FALSE and the IUPAC code
otherwise.
Make sense only for nucleic acid sequences (DNA or RNA).
The consensus character is defined if possible by an IUPAC symbol by
function bma. If this is not possible, when there is a gap
character for instance, NA is returned.
With this method a matrix with the count of each possible character at each position is returned.
con is a short form for consensus.
Either a vector of single characters with possible NA or a matrix with
the method profile.
J.R. Lobry
citation("seqinr")
See read.alignment to import alignment from files.
# # Read 5 aligned DNA sequences at 42 sites: # phylip <- read.alignment(file = system.file("sequences/test.phylip", package = "seqinr"), format = "phylip") # # Show data in a matrix form: # (matali <- as.matrix(phylip)) # # With the majority rule: # res <- consensus(phylip) stopifnot(c2s(res) == "aaaccctggccgttcagggtaaaccgtggccgggcagggtat") # # With a threshold: # res.thr <- consensus(phylip, method = "threshold") res.thr[is.na(res.thr)] <- "." # change NA into dots # stopifnot(c2s(res.thr) == "aa.c..t.gc.gtt..g..t.a.cc..ggccg.......ta.") stopifnot(c2s(res.thr) == "aa.cc.tggccgttcagggtaaacc.tggccgg.cagggtat") # # With a threshold and threshold.IUPAC set to TRUE: # res.thr <- consensus(phylip, method = "threshold",threshold.IUPAC =TRUE ) stopifnot(c2s(res.thr) == "aavccntggccgttcagggtaaaccntggccggdcagggtat") # # With an IUPAC summary: # res.iup <- consensus(phylip, method = "IUPAC") stopifnot(c2s(res.iup) == "amvsbnkkgcmkkkmmgsktrmrssndkgcmrkdmmvskyaw") # replace 3 and 4-fold symbols by dots: res.iup[match(res.iup, s2c("bdhvn"), nomatch = 0) > 0] <- "." stopifnot(c2s(res.iup) == "am.s..kkgcmkkkmmgsktrmrss..kgcmrk.mm.skyaw") # # With a profile method: # (res <- consensus(phylip, method = "profile")) # # Show the connection between the profile and some consensus: # bxc <- barplot(res, col = c("green", "blue", "orange", "white", "red"), border = NA, space = 0, las = 2, ylab = "Base count", main = "Profile of a DNA sequence alignment", xlab = "sequence position", xaxs = "i") text(x = bxc, y = par("usr")[4],lab = res.thr, pos = 3, xpd = NA) text(x = bxc, y = par("usr")[1],lab = res.iup, pos = 1, xpd = NA)# # Read 5 aligned DNA sequences at 42 sites: # phylip <- read.alignment(file = system.file("sequences/test.phylip", package = "seqinr"), format = "phylip") # # Show data in a matrix form: # (matali <- as.matrix(phylip)) # # With the majority rule: # res <- consensus(phylip) stopifnot(c2s(res) == "aaaccctggccgttcagggtaaaccgtggccgggcagggtat") # # With a threshold: # res.thr <- consensus(phylip, method = "threshold") res.thr[is.na(res.thr)] <- "." # change NA into dots # stopifnot(c2s(res.thr) == "aa.c..t.gc.gtt..g..t.a.cc..ggccg.......ta.") stopifnot(c2s(res.thr) == "aa.cc.tggccgttcagggtaaacc.tggccgg.cagggtat") # # With a threshold and threshold.IUPAC set to TRUE: # res.thr <- consensus(phylip, method = "threshold",threshold.IUPAC =TRUE ) stopifnot(c2s(res.thr) == "aavccntggccgttcagggtaaaccntggccggdcagggtat") # # With an IUPAC summary: # res.iup <- consensus(phylip, method = "IUPAC") stopifnot(c2s(res.iup) == "amvsbnkkgcmkkkmmgsktrmrssndkgcmrkdmmvskyaw") # replace 3 and 4-fold symbols by dots: res.iup[match(res.iup, s2c("bdhvn"), nomatch = 0) > 0] <- "." stopifnot(c2s(res.iup) == "am.s..kkgcmkkkmmgsktrmrss..kgcmrk.mm.skyaw") # # With a profile method: # (res <- consensus(phylip, method = "profile")) # # Show the connection between the profile and some consensus: # bxc <- barplot(res, col = c("green", "blue", "orange", "white", "red"), border = NA, space = 0, las = 2, ylab = "Base count", main = "Profile of a DNA sequence alignment", xlab = "sequence position", xaxs = "i") text(x = bxc, y = par("usr")[4],lab = res.thr, pos = 3, xpd = NA) text(x = bxc, y = par("usr")[1],lab = res.iup, pos = 1, xpd = NA)
Counts the number of times dimer/trimer/etc oligomers occur in a sequence. Note that the oligomers are overlapping by default.
count(seq, wordsize, start = 0, by = 1, freq = FALSE, alphabet = s2c("acgt"), frame = start)count(seq, wordsize, start = 0, by = 1, freq = FALSE, alphabet = s2c("acgt"), frame = start)
seq |
a vector of single characters. |
wordsize |
an integer giving the size of word (n-mer) to count. |
start |
an integer (0, 1, 2,...) giving the starting position to consider in the sequence. The default value 0 means that we start at the first nucleotide in the sequence. |
by |
an integer defaulting to 1 for the window step. |
freq |
if TRUE, word relative frequencies (summing to 1) are returned instead of counts |
alphabet |
a vector of single characters used to build the oligomer set. |
frame |
synonymous for start |
count counts the occurence of all words by moving a window of
length word. The window step is controlled by the argument by.
start controls the starting position in the sequence for the count.
This function returns a table whose dimnames are all the possible
oligomers. All oligomers are returned, even if absent from
the sequence.
D. Charif, J.R. Lobry with suggestions from Gabriel Valiente, Stefanie Hartmann and Christian Gautier
citation("seqinr")
table for the class of the returned objet. See rho and
zscore for dinucleotide statistics.
a <- s2c("acgggtacggtcccatcgaa") ## ## To count dinucleotide occurrences in sequence a: ## count(a, word = 2) ## ## To count trinucleotide occurrences in sequence a, with start = 2: ## count(a, word = 3, start = 2) ## ## To count dinucleotide relative frequencies in sequence a: ## count(a, word = 2, freq = TRUE) ## ## To count dinucleotides in codon positions III-I in a coding sequence: ## alldinuclIIIpI <- s2c("NNaaNatNttNtgNgtNtcNctNtaNagNggNgcNcgNgaNacNccNcaNN") resIIIpI <- count(alldinuclIIIpI, word = 2, start = 2, by = 3) stopifnot(all( resIIIpI == 1)) ## ## Simple sanity check: ## #alldinucl <- "aattgtctaggcgacca" #stopifnot(all(count(s2c(alldinucl), 2) == 1)) #alldiaa <- "aaxxzxbxvxyxwxtxsxpxfxmxkxlxixhxgxexqxcxdxnxrxazzbzvzyzwztzszpzfzmzkzlzizhzgzezqzczdznz #rzabbvbybwbtbsbpbfbmbkblbibhbgbebqbcbdbnbrbavvyvwvtvsvpvfvmvkvlvivhvgvevqvcvdvnvrvayywytysypyfymyky #lyiyhygyeyqycydynyryawwtwswpwfwmwkwlwiwhwgwewqwcwdwnwrwattstptftmtktltithtgtetqtctdtntrtasspsfsmsks #lsishsgsesqscsdsnsrsappfpmpkplpiphpgpepqpcpdpnprpaffmfkflfifhfgfefqfcfdfnfrfammkmlmimhmgmemqmcmdmnm #rmakklkikhkgkekqkckdknkrkallilhlglelqlcldlnlrlaiihigieiqicidiniriahhghehqhchdhnhrhaggegqgcgdgngrgae #eqecedenereaqqcqdqnqrqaccdcncrcaddndrdannrnarra" #stopifnot(all(count(s2c(alldiaa), 2, alphabet = s2c("arndcqeghilkmfpstwyvbzx")) == 1)) ## ## Example with dinucleotide count in the complete Human mitochondrion genome: ## humanMito <- read.fasta(file = system.file("sequences/humanMito.fasta", package = "seqinr")) ## ## Get the dinucleotide count: ## dinu <- count(humanMito[[1]], 2) ## ## Put the results in a 4 X 4 array: ## dinu2 <- dinu dim(dinu2) <- c(4, 4) nucl <- s2c("ACGT") dimnames(dinu2) <- list(paste(nucl, "-3\'", sep = ""), paste("5\'-", nucl, sep = "")) ## ## Show that CpG and GpT dinucleotides are depleted: ## mosaicplot(t(dinu2), shade = TRUE, main = "Dinucleotide XpY frequencies in the Human\nmitochondrion complete genome", xlab = "First nucleotide: Xp", ylab = "Second nucleotide: pY", las = 1, cex = 1) mtext("Note the depletion in CpG and GpT dinucleotides", side = 1, line = 3)a <- s2c("acgggtacggtcccatcgaa") ## ## To count dinucleotide occurrences in sequence a: ## count(a, word = 2) ## ## To count trinucleotide occurrences in sequence a, with start = 2: ## count(a, word = 3, start = 2) ## ## To count dinucleotide relative frequencies in sequence a: ## count(a, word = 2, freq = TRUE) ## ## To count dinucleotides in codon positions III-I in a coding sequence: ## alldinuclIIIpI <- s2c("NNaaNatNttNtgNgtNtcNctNtaNagNggNgcNcgNgaNacNccNcaNN") resIIIpI <- count(alldinuclIIIpI, word = 2, start = 2, by = 3) stopifnot(all( resIIIpI == 1)) ## ## Simple sanity check: ## #alldinucl <- "aattgtctaggcgacca" #stopifnot(all(count(s2c(alldinucl), 2) == 1)) #alldiaa <- "aaxxzxbxvxyxwxtxsxpxfxmxkxlxixhxgxexqxcxdxnxrxazzbzvzyzwztzszpzfzmzkzlzizhzgzezqzczdznz #rzabbvbybwbtbsbpbfbmbkblbibhbgbebqbcbdbnbrbavvyvwvtvsvpvfvmvkvlvivhvgvevqvcvdvnvrvayywytysypyfymyky #lyiyhygyeyqycydynyryawwtwswpwfwmwkwlwiwhwgwewqwcwdwnwrwattstptftmtktltithtgtetqtctdtntrtasspsfsmsks #lsishsgsesqscsdsnsrsappfpmpkplpiphpgpepqpcpdpnprpaffmfkflfifhfgfefqfcfdfnfrfammkmlmimhmgmemqmcmdmnm #rmakklkikhkgkekqkckdknkrkallilhlglelqlcldlnlrlaiihigieiqicidiniriahhghehqhchdhnhrhaggegqgcgdgngrgae #eqecedenereaqqcqdqnqrqaccdcncrcaddndrdannrnarra" #stopifnot(all(count(s2c(alldiaa), 2, alphabet = s2c("arndcqeghilkmfpstwyvbzx")) == 1)) ## ## Example with dinucleotide count in the complete Human mitochondrion genome: ## humanMito <- read.fasta(file = system.file("sequences/humanMito.fasta", package = "seqinr")) ## ## Get the dinucleotide count: ## dinu <- count(humanMito[[1]], 2) ## ## Put the results in a 4 X 4 array: ## dinu2 <- dinu dim(dinu2) <- c(4, 4) nucl <- s2c("ACGT") dimnames(dinu2) <- list(paste(nucl, "-3\'", sep = ""), paste("5\'-", nucl, sep = "")) ## ## Show that CpG and GpT dinucleotides are depleted: ## mosaicplot(t(dinu2), shade = TRUE, main = "Dinucleotide XpY frequencies in the Human\nmitochondrion complete genome", xlab = "First nucleotide: Xp", ylab = "Second nucleotide: pY", las = 1, cex = 1) mtext("Note the depletion in CpG and GpT dinucleotides", side = 1, line = 3)
Returns the number of free lists available list of names of annotation lines in the opened ACNUC database.
countfreelists(socket = autosocket()) cfl(socket = autosocket())countfreelists(socket = autosocket()) cfl(socket = autosocket())
socket |
an object of class |
a list with the following 2 components:
free |
numeric. The number of free lists |
annotlines |
vector of strings. Names of annotation lines |
J.R. Lobry
https://doua.prabi.fr/databases/acnuc.html
citation("seqinr")
## Not run: # Need internet connection choosebank("emblTP") (rescountfreelists <- countfreelists()) stopifnot(all(rescountfreelists$annotlines == c("ALL", "AC", "PR", "DT", "KW", "OS", "OC", "OG", "RN", "RC", "RP", "RX", "RG", "RA", "RT", "RL", "DR", "CC", "AH", "AS", "FH", "FT", "CO", "SQ", "SEQ"))) closebank() ## End(Not run)## Not run: # Need internet connection choosebank("emblTP") (rescountfreelists <- countfreelists()) stopifnot(all(rescountfreelists$annotlines == c("ALL", "AC", "PR", "DT", "KW", "OS", "OC", "OG", "RN", "RC", "RP", "RX", "RG", "RA", "RT", "RL", "DR", "CC", "AH", "AS", "FH", "FT", "CO", "SQ", "SEQ"))) closebank() ## End(Not run)
Returns the number of subsequences in the ACNUC list of rank lrank.
countsubseqs(lrank, socket = autosocket()) css(lrank, socket = autosocket())countsubseqs(lrank, socket = autosocket()) css(lrank, socket = autosocket())
lrank |
the rank of the ACNUC list to consider. |
socket |
an object of class |
Numeric.
J.R. Lobry
https://doua.prabi.fr/databases/acnuc.html
citation("seqinr")
choosebank, query, glr to
get a list rank from its name.
## Not run: # Need internet connection choosebank("emblTP") mylist<-query("mylist", "N=@", virtual = TRUE) # select all (seqs + subseqs) mylist$nelem # 14138094 seqs + subseqs stopifnot(mylist$nelem == 14138094) css(glr("mylist")) # 1604500 subsequences only stopifnot(css(glr("mylist")) == 1604500) closebank() ## End(Not run)## Not run: # Need internet connection choosebank("emblTP") mylist<-query("mylist", "N=@", virtual = TRUE) # select all (seqs + subseqs) mylist$nelem # 14138094 seqs + subseqs stopifnot(mylist$nelem == 14138094) css(glr("mylist")) # 1604500 subsequences only stopifnot(css(glr("mylist")) == 1604500) closebank() ## End(Not run)
This function is usefull if you have a local file with sequence names (sequence ID), or sequence accession numbers, or species names, or keywords. This allows you to create on the server a list with the corresponding items.
crelistfromclientdata(listname, file, type, socket = autosocket(), invisible = TRUE, verbose = FALSE, virtual = FALSE) clfcd(listname, file, type, socket = autosocket(), invisible = TRUE, verbose = FALSE, virtual = FALSE)crelistfromclientdata(listname, file, type, socket = autosocket(), invisible = TRUE, verbose = FALSE, virtual = FALSE) clfcd(listname, file, type, socket = autosocket(), invisible = TRUE, verbose = FALSE, virtual = FALSE)
listname |
The name of the list as a quoted string of chars |
file |
The local file name |
type |
Could be one of "SQ", "AC", "SP", "KW", see examples |
socket |
an object of class |
invisible |
if |
verbose |
if |
virtual |
if |
clfcd is a shortcut for crelistfromclientdata.
The result is directly assigned to the object listname in the user workspace.
This is an objet of class qaw, a list with the following 6 components:
call |
the original call |
name |
the ACNUC list name |
nelem |
the number of elements (for instance sequences) in the ACNUC list |
typelist |
the type of the elements of the list. Could be SQ for a list of sequence names, KW for a list of keywords, SP for a list of species names. |
req |
a list of sequence names that fit the required criteria or |
socket |
the socket connection that was used |
J.R. Lobry
citation("seqinr")
choosebank,
query, savelist for the reverse operation with
an ACNUC list of sequences.
## Not run: # Need internet connection choosebank("emblTP") # # Example with a file that contains sequence names: # fileSQ <- system.file("sequences/bb.mne", package = "seqinr") listSQ <- crelistfromclientdata("listSQ", file = fileSQ, type = "SQ") sapply(listSQ$req, getName) # # Example with a file that contains sequence accession numbers: # fileAC <- system.file("sequences/bb.acc", package = "seqinr") listAC <- crelistfromclientdata("listAC", file = fileAC, type = "AC") sapply(listAC$req, getName) # # Example with a file that contains species names: # fileSP <- system.file("sequences/bb.sp", package = "seqinr") listSP <- crelistfromclientdata("listSP", file = fileSP, type = "SP") sapply(listSP$req, getName) # # Example with a file that contains keywords: # fileKW <- system.file("sequences/bb.kwd", package = "seqinr") listKW <- crelistfromclientdata("listKW", file = fileKW, type = "KW") sapply(listKW$req, getName) # # Summary of ACNUC lists: # sapply(alr()$rank, getliststate) closebank() ## End(Not run)## Not run: # Need internet connection choosebank("emblTP") # # Example with a file that contains sequence names: # fileSQ <- system.file("sequences/bb.mne", package = "seqinr") listSQ <- crelistfromclientdata("listSQ", file = fileSQ, type = "SQ") sapply(listSQ$req, getName) # # Example with a file that contains sequence accession numbers: # fileAC <- system.file("sequences/bb.acc", package = "seqinr") listAC <- crelistfromclientdata("listAC", file = fileAC, type = "AC") sapply(listAC$req, getName) # # Example with a file that contains species names: # fileSP <- system.file("sequences/bb.sp", package = "seqinr") listSP <- crelistfromclientdata("listSP", file = fileSP, type = "SP") sapply(listSP$req, getName) # # Example with a file that contains keywords: # fileKW <- system.file("sequences/bb.kwd", package = "seqinr") listKW <- crelistfromclientdata("listKW", file = fileKW, type = "KW") sapply(listKW$req, getName) # # Summary of ACNUC lists: # sapply(alr()$rank, getliststate) closebank() ## End(Not run)
This function tries to download the last update of the GOLD (Genomes OnLine Database) to extract bacterial genomes sizes when available. The histogram and the default density() output is produced. Optionally, a maximum likelihood estimate of a superposition of two or three normal distributions is also represented.
dia.bactgensize(fit = 2, p = 0.5, m1 = 2000, sd1 = 600, m2 = 4500, sd2 = 1000, p3 = 0.05, m3 = 9000, sd3 = 1000, maxgensize = 20000, source = c("https://pbil.univ-lyon1.fr/datasets/seqinr/data/goldtable15Dec07.txt"))dia.bactgensize(fit = 2, p = 0.5, m1 = 2000, sd1 = 600, m2 = 4500, sd2 = 1000, p3 = 0.05, m3 = 9000, sd3 = 1000, maxgensize = 20000, source = c("https://pbil.univ-lyon1.fr/datasets/seqinr/data/goldtable15Dec07.txt"))
fit |
integer value. If |
p |
initial guess for the proportion of the first population. |
m1 |
initial guess for the mean of the first population. |
sd1 |
initial guess for the standard deviation of the first population. |
m2 |
initial guess for the mean of the second population. |
sd2 |
initial guess for the standard deviation of the second population. |
p3 |
initial guess for the proportion of the third population. |
m3 |
initial guess for the mean of the third population. |
sd3 |
initial guess for the standard deviation of the third population. |
maxgensize |
maximum admissive value in bp for a bacterial genome size: only value less or equal to this threshold are considrered. |
source |
the file with raw data. By default a local (outdated) copy is used. |
An invisible dataframe with three components:
genus |
genus name |
species |
species names |
gs |
genome size in Kb |
J.R. Lobry
Please cite the following references when using data from GOLD:
Kyrpides, N.C. (1999) Genomes OnLine Database (GOLD 1.0): a monitor
of complete and ongoing genome projects world-wide.
Bioinformatics, 15:773-774.
Bernal, A., Ear, U., Kyrpides, N. (2001) Genomes OnLine Database (GOLD):
a monitor of genome projects world-wide.
Nucleic Acids Research, 29:126-127.
Liolios, K., Tavernarakis, N., Hugenholtz, P., Kyrpides, N.C. (2006)
The Genomes On Line Database (GOLD) v.2: a monitor of genome
projects worldwide.
Nucleic Acids Research, 34:D332-D334.
Liolios, K., Mavrommatis, K., Tavernarakis, N., Kyrpides, N.C. (2008)
The Genomes On Line Database (GOLD) in 2007: status of genomic
and metagenomic projects and their associated metadata.
Nucleic Acids Research,
in press:D000-D000.
citation("seqinr")
## Not run: # Need internet connection # # With a local outdated copy from GOLD: # dia.bactgensize() # # With last GOLD data: # # The URL is no more accessible. # dia.bactgensize(source = "http://www.genomesonline.org/DBs/goldtable.txt") ## End(Not run)## Not run: # Need internet connection # # With a local outdated copy from GOLD: # dia.bactgensize() # # With last GOLD data: # # The URL is no more accessible. # dia.bactgensize(source = "http://www.genomesonline.org/DBs/goldtable.txt") ## End(Not run)
This dataset contains the mean zscores as computed on all intergenic sequences (intergenic) and on all CDS (coding) from 242 complete bacterial chromosomes (as retrieved from Genome Reviews database on June 16, 2005).
data(dinucl)data(dinucl)
List of two dataframes of 242 chromosomes and 16 dinucleotides: one for intergenic, one for coding sequences.
the mean of zscore computed with the base
model on each intergenic sequence
the mean of zscore computed with the codon
model on each coding sequence
Palmeira, L., Guéguen, L. and Lobry JR. (2006) UV-targeted dinucleotides
are not depleted in light-exposed Prokaryotic genomes.
Molecular Biology and Evolution,
23:2214-2219.
doi:10.1093/molbev/msl096
citation("seqinr")
data(dinucl) par(mfrow = c(2, 2), mar = c(4,4,0.5,0.5)+0.1) myplot <- function(x){ plot(dinucl$intergenic[, x], dinucl$coding[, x], xlab = "intergenic", ylab = "coding", las = 1, ylim = c(-6, 4), xlim = c(-3, 3), cex = 0) rect(-10,-10,-1.96,10,col="yellow", border = "yellow") rect(1.96,-10,10,10,col="yellow", border = "yellow") rect(-10,-10,10,-1.96,col="yellow", border = "yellow") rect(-10,1.96,10,10,col="yellow", border = "yellow") abline(v=0,lty=3) abline(h=0,lty=3) abline(h=-1.96,lty=2) abline(h=+1.96,lty=2) abline(v=-1.96,lty=2) abline(v=+1.96,lty=2) points(dinucl$intergenic[, x], dinucl$coding[, x], pch = 21, col = rgb(.1,.1,.1,.5), bg = rgb(.5,.5,.5,.5)) legend("bottomright", inset = 0.02, legend = paste(substr(x,1,1), "p", substr(x,2,2), " bias", sep = ""), cex = 1.25, bg = "white") box() } myplot("CT") myplot("TC") myplot("CC") myplot("TT")data(dinucl) par(mfrow = c(2, 2), mar = c(4,4,0.5,0.5)+0.1) myplot <- function(x){ plot(dinucl$intergenic[, x], dinucl$coding[, x], xlab = "intergenic", ylab = "coding", las = 1, ylim = c(-6, 4), xlim = c(-3, 3), cex = 0) rect(-10,-10,-1.96,10,col="yellow", border = "yellow") rect(1.96,-10,10,10,col="yellow", border = "yellow") rect(-10,-10,10,-1.96,col="yellow", border = "yellow") rect(-10,1.96,10,10,col="yellow", border = "yellow") abline(v=0,lty=3) abline(h=0,lty=3) abline(h=-1.96,lty=2) abline(h=+1.96,lty=2) abline(v=-1.96,lty=2) abline(v=+1.96,lty=2) points(dinucl$intergenic[, x], dinucl$coding[, x], pch = 21, col = rgb(.1,.1,.1,.5), bg = rgb(.5,.5,.5,.5)) legend("bottomright", inset = 0.02, legend = paste(substr(x,1,1), "p", substr(x,2,2), " bias", sep = ""), cex = 1.25, bg = "white") box() } myplot("CT") myplot("TC") myplot("CC") myplot("TT")
These two functions compute two different types of statistics for the measure of statistical dinculeotide over- and under-representation : the rho statistic, and the z-score, each computed for all 16 dinucleotides.
rho(sequence, wordsize = 2, alphabet = s2c("acgt")) zscore(sequence, simulations = NULL, modele, exact = FALSE, alphabet = s2c("acgt"), ... )rho(sequence, wordsize = 2, alphabet = s2c("acgt")) zscore(sequence, simulations = NULL, modele, exact = FALSE, alphabet = s2c("acgt"), ... )
sequence |
a vector of single characters. |
wordsize |
an integer giving the size of word (n-mer) to consider. |
simulations |
If |
modele |
A string of characters describing the model chosen for the random generation |
exact |
Whether exact analytical calculation or an approximation should be used |
alphabet |
A vector of single characters. |
... |
Optional parameters for specific model permutations are
passed on to |
The rho statistic, as presented in Karlin S., Cardon LR. (1994), can
be computed on each of the 16 dinucleotides. It is the frequence of
dinucleotide xy divided by the product of frequencies of
nucleotide x and nucleotide y. It is equal to 1.00 when
dinucleotide xy is formed by pure chance, and it is superior
(respectively inferior) to 1.00 when dinucleotide xy is over-
(respectively under-) represented. Note that if you want to reproduce
Karlin's results you have to compute the statistic from the sequence
concatenated with its inverted complement that is with something
like rho(c(myseq, rev(comp(myseq)))).
The zscore statistic, as presented in Palmeira, L., Guéguen, L.
and Lobry JR. (2006). The statistic is the normalization of the
rho statistic by its expectation and variance according to a
given random sequence generation model, and follows the
standard normal distribution. This statistic can be computed
with several models (cf. permutation for the description
of each of the models). We provide analytical calculus for two of
them: the base permutations model and the codon
permutations model.
The base model allows for random sequence generation by
shuffling (with/without replacement) of all bases in the sequence.
Analytical computations are available for this model: either as an
approximation for large sequences (cf. Palmeira, L., Guéguen, L.
and Lobry JR. (2006)), either as the exact analytical formulae
(cf. Schbath, S. (1995)).
The position model allows for random sequence generation
by shuffling (with/without replacement) of bases within their
position in the codon (bases in position I, II or III stay in
position I, II or III in the new sequence.
The codon model allows for random sequence generation by
shuffling (with/without replacement) of codons. Analytical
computation is available for this model (Gautier, C., Gouy, M. and
Louail, S. (1985)).
The syncodon model allows for random sequence generation
by shuffling (with/without replacement) of synonymous codons.
a table containing the computed statistic for each dinucleotide
L. Palmeira, J.R. Lobry with suggestions from A. Coghlan.
Gautier, C., Gouy, M. and Louail, S. (1985) Non-parametric statistics for nucleic acid sequence study. Biochimie, 67:449-453.
Karlin S. and Cardon LR. (1994) Computational DNA sequence analysis. Annu Rev Microbiol, 48:619-654.
Schbath, S. (1995) Étude asymptotique du nombre d'occurrences d'un mot dans une chaîne de Markov et application à la recherche de mots de fréquence exceptionnelle dans les séquences d'ADN. Thèse de l'Université René Descartes, Paris V
Palmeira, L., Guéguen, L. and Lobry, J.R. (2006) UV-targeted dinucleotides are not depleted in light-exposed Prokaryotic genomes. Molecular Biology and Evolution, 23:2214-2219. doi:10.1093/molbev/msl096
citation("seqinr")
## Not run: sequence <- sample(x = s2c("acgt"), size = 6000, replace = TRUE) rho(sequence) zscore(sequence, modele = "base") zscore(sequence, modele = "base", exact = TRUE) zscore(sequence, modele = "codon") zscore(sequence, simulations = 1000, modele = "syncodon") ## End(Not run)## Not run: sequence <- sample(x = s2c("acgt"), size = 6000, replace = TRUE) rho(sequence) zscore(sequence, modele = "base") zscore(sequence, modele = "base", exact = TRUE) zscore(sequence, modele = "codon") zscore(sequence, simulations = 1000, modele = "syncodon") ## End(Not run)
These functions compute a matrix of pairwise distances from aligned sequences using similarity (Fitch matrix, for protein sequences only) or identity matrix (for protein and DNA sequences). The resulting matrix contains the squared root of the pairwise distances. For example, if identity between 2 sequences is 80 the squared root of (1.0 - 0.8) i.e. 0.4472136. Note: seqinr::dist.alignment is the square root version of ape::dist.gene (and not ape::dist.dna).
dist.alignment(x, matrix = c("identity", "similarity"),gap)dist.alignment(x, matrix = c("identity", "similarity"),gap)
x |
an object of class |
matrix |
the matrix distance to be used, partial matching allowed |
gap |
-optional- logical, with identity matrix, if set to |
The distance matrix, object of class dist, computed by using the
specified distance measure.
D. Charif, J.R. Lobry
The reference for the similarity matrix is :
Fitch, W.M. (1966) An improved method of testing for evolutionary homology.
J. Mol. Biol., 16:9-16.
citation("seqinr")
myseqs <- read.alignment(file = system.file("sequences/test.mase", package = "seqinr"), format = "mase") dist.alignment(myseqs, matrix = "identity" ) as.matrix(dist.alignment(myseqs, matrix = "identity" ))myseqs <- read.alignment(file = system.file("sequences/test.mase", package = "seqinr"), format = "mase") dist.alignment(myseqs, matrix = "identity" ) as.matrix(dist.alignment(myseqs, matrix = "identity" ))
Draw a Cleveland dot plot for codon usage tables
dotchart.uco(x, numcode = 1, aa3 = TRUE, pt.cex = 0.7, alphabet = s2c("tcag"), pch = 21, gpch = 20, bg = par("bg"), cex = 0.7, color = "black", gcolor = "black", lcolor = grey(0.9), xlim, offset = 0.4, ...)dotchart.uco(x, numcode = 1, aa3 = TRUE, pt.cex = 0.7, alphabet = s2c("tcag"), pch = 21, gpch = 20, bg = par("bg"), cex = 0.7, color = "black", gcolor = "black", lcolor = grey(0.9), xlim, offset = 0.4, ...)
x |
table of codon usage as computed by |
numcode |
the number of the code to be used by |
aa3 |
logical. If TRUE use the three-letter code for amino- acids. If FALSE use the one-letter code for amino-acids. |
pt.cex |
the character size to be used for points. |
alphabet |
character for codons labels |
pch |
the plotting character or symbol to be used. |
gpch |
the plotting character or symbol to be used for group values. |
bg |
the background color to be used. |
cex |
the character expansion size passed to |
color |
the color(s) to be used for points an labels. |
gcolor |
the single color to be used for group labels and values. |
lcolor |
the color(s) to be used for the horizontal lines. |
xlim |
horizontal range for the plot |
offset |
offset in inches of ylab and labels; was hardwired to 0.4 before R 4.0.0 |
... |
graphical parameters can also be specified as arguments |
An invisible list with components:
x |
table of codon usage |
labels |
codon names |
groups |
amino acid factor |
gdata |
sums by amino acid |
ypg |
the y-axis coordinates for amino acids |
ypi |
the y-axis coordinates for codons |
J.R. Lobry
Cleveland, W. S. (1985) The Elements of Graphing Data.
Monterey, CA: Wadsworth.
citation("seqinr")
# Load dataset: data(ec999) # Compute codon usage for all coding sequences: ec999.uco <- lapply(ec999, uco, index="eff") # Put it in a dataframe: df <- as.data.frame(lapply(ec999.uco, as.vector)) # Add codon names: row.names(df) <- names(ec999.uco[[1]]) # Compute global codon usage: global <- rowSums(df) # Choose a title for the graph: title <- "Codon usage in 999 E. coli coding sequences" # Plot data: dotchart.uco(global, main = title)# Load dataset: data(ec999) # Compute codon usage for all coding sequences: ec999.uco <- lapply(ec999, uco, index="eff") # Put it in a dataframe: df <- as.data.frame(lapply(ec999.uco, as.vector)) # Add codon names: row.names(df) <- names(ec999.uco[[1]]) # Compute global codon usage: global <- rowSums(df) # Choose a title for the graph: title <- "Codon usage in 999 E. coli coding sequences" # Plot data: dotchart.uco(global, main = title)
Dot plots are most likely the oldest visual representation used to compare two sequences (see Maizel and Lenk 1981 and references therein). In its simplest form, a dot is produced at position (i,j) iff character number i in the first sequence is the same as character number j in the second sequence. More eleborated forms use sliding windows and a threshold value for two windows to be considered as matched.
dotPlot(seq1, seq2, wsize = 1, wstep = 1, nmatch = 1, shift = 0, col = c("white", "black"), xlab = deparse(substitute(seq1)), ylab = deparse(substitute(seq2)), ...)dotPlot(seq1, seq2, wsize = 1, wstep = 1, nmatch = 1, shift = 0, col = c("white", "black"), xlab = deparse(substitute(seq1)), ylab = deparse(substitute(seq2)), ...)
seq1 |
the first sequence (x-axis) as a vector of single chars. |
seq2 |
the second sequence (y-axis) as a vector of single char. |
wsize |
the size in chars of the moving window. |
wstep |
the size in chars for the steps of the moving window.
Use |
nmatch |
if the number of match per window is greater than or equal
to |
shift |
the number of chars to shift in seq2 when generating the moving window. |
col |
color of points passed to |
xlab |
label of x-axis passed to |
ylab |
label of y-axis passed to |
... |
further arguments passed to |
NULL.
J.R. Lobry
Maizel, J.V. and Lenk, R.P. (1981) Enhanced Graphic Matrix Analysis of
Nucleic Acid and Protein Sequences.
Proceedings of the National Academy of Science USA,
78:7665-7669.
citation("seqinr")
# # Identity is on the main diagonal: # dotPlot(letters, letters, main = "Direct repeat") # # Internal repeats are off the main diagonal: # dotPlot(rep(letters, 2), rep(letters, 2), main = "Internal repeats") # # Inversions are orthogonal to the main diagonal: # dotPlot(letters, rev(letters), main = "Inversion") # # Insertion in the second sequence yields a vertical jump: # dotPlot(letters, c(letters[1:10], s2c("insertion"), letters[11:26]), main = "Insertion in the second sequence", asp = 1) # # Insertion in the first sequence yields an horizontal jump: # dotPlot(c(letters[1:10], s2c("insertion"), letters[11:26]), letters, main = "Insertion in the first sequence", asp = 1) # # Protein sequences have usually a good signal/noise ratio because there # are 20 possible amino-acids: # aafile <- system.file("sequences/seqAA.fasta", package = "seqinr") protein <- read.fasta(aafile)[[1]] dotPlot(protein, protein, main = "Dot plot of a protein\nwsize = 1, wstep = 1, nmatch = 1") # # Nucleic acid sequences have usually a poor signal/noise ratio because # there are only 4 different bases: # dnafile <- system.file("sequences/malM.fasta", package = "seqinr") dna <- protein <- read.fasta(dnafile)[[1]] dotPlot(dna[1:200], dna[1:200], main = "Dot plot of a nucleic acid sequence\nwsize = 1, wstep = 1, nmatch = 1") # # Play with the wsize, wstep and nmatch arguments to increase the # signal/noise ratio: # dotPlot(dna[1:200], dna[1:200], wsize = 3, wstep = 3, nmatch = 3, main = "Dot plot of a nucleic acid sequence\nwsize = 3, wstep = 3, nmatch = 3")# # Identity is on the main diagonal: # dotPlot(letters, letters, main = "Direct repeat") # # Internal repeats are off the main diagonal: # dotPlot(rep(letters, 2), rep(letters, 2), main = "Internal repeats") # # Inversions are orthogonal to the main diagonal: # dotPlot(letters, rev(letters), main = "Inversion") # # Insertion in the second sequence yields a vertical jump: # dotPlot(letters, c(letters[1:10], s2c("insertion"), letters[11:26]), main = "Insertion in the second sequence", asp = 1) # # Insertion in the first sequence yields an horizontal jump: # dotPlot(c(letters[1:10], s2c("insertion"), letters[11:26]), letters, main = "Insertion in the first sequence", asp = 1) # # Protein sequences have usually a good signal/noise ratio because there # are 20 possible amino-acids: # aafile <- system.file("sequences/seqAA.fasta", package = "seqinr") protein <- read.fasta(aafile)[[1]] dotPlot(protein, protein, main = "Dot plot of a protein\nwsize = 1, wstep = 1, nmatch = 1") # # Nucleic acid sequences have usually a poor signal/noise ratio because # there are only 4 different bases: # dnafile <- system.file("sequences/malM.fasta", package = "seqinr") dna <- protein <- read.fasta(dnafile)[[1]] dotPlot(dna[1:200], dna[1:200], main = "Dot plot of a nucleic acid sequence\nwsize = 1, wstep = 1, nmatch = 1") # # Play with the wsize, wstep and nmatch arguments to increase the # signal/noise ratio: # dotPlot(dna[1:200], dna[1:200], wsize = 3, wstep = 3, nmatch = 3, main = "Dot plot of a nucleic acid sequence\nwsize = 3, wstep = 3, nmatch = 3")
Graphical representation for nucleotide skews in prokaryotic chromosomes.
draw.oriloc(ori, main = "Title", xlab = "Map position in Kb", ylab = "Cumulated combined skew in Kb", las = 1, las.right = 3, ta.mtext = "Cumul. T-A skew", ta.col = "pink", ta.lwd = 1, cg.mtext = "Cumul. C-G skew", cg.col = "lightblue", cg.lwd = 1, cds.mtext = "Cumul. CDS skew", cds.col = "lightgreen", cds.lwd = 1, sk.col = "black", sk.lwd = 2, add.grid = TRUE, ...)draw.oriloc(ori, main = "Title", xlab = "Map position in Kb", ylab = "Cumulated combined skew in Kb", las = 1, las.right = 3, ta.mtext = "Cumul. T-A skew", ta.col = "pink", ta.lwd = 1, cg.mtext = "Cumul. C-G skew", cg.col = "lightblue", cg.lwd = 1, cds.mtext = "Cumul. CDS skew", cds.col = "lightgreen", cds.lwd = 1, sk.col = "black", sk.lwd = 2, add.grid = TRUE, ...)
ori |
A data frame obtained with the |
main |
The main title of the plot. |
xlab |
The x-axis title. |
ylab |
The y-axis title. |
las |
The style of axis labels for the bottom and left axes. |
las.right |
The style of axis labels for the right axis. |
ta.mtext |
The marginal legend for the TA skew. |
ta.col |
The color for the TA skew. |
ta.lwd |
The line width for the TA skew. |
cg.mtext |
The marginal legend for the CG skew. |
cg.col |
The color for the CG skew. |
cg.lwd |
The line width for the CG skew. |
cds.mtext |
The marginal legend for the CDS skew. |
cds.col |
The color for the CDS skew. |
cds.lwd |
The line width for the CDS skew. |
sk.col |
The color for the cumulated combined skew. |
sk.lwd |
The line width for the cumulated combined skew. |
add.grid |
Logical, if |
... |
Further arguments are passed to the function |
J.R. Lobry
citation("seqinr")
oriloc, rearranged.oriloc,
extract.breakpoints
## Not run: # need internet connection # # Example with Chlamydia trachomatis complete genome # ori <- oriloc() draw.oriloc(ori) # # The same, using more options from function draw.oriloc() # draw.oriloc(ori, main = expression(italic(Chlamydia~~trachomatis)~~complete~~genome), ta.mtext = "TA skew", ta.col = "red", cg.mtext = "CG skew", cg.col = "blue", cds.mtext = "CDS skew", cds.col = "seagreen", add.grid = FALSE) ## End(Not run)## Not run: # need internet connection # # Example with Chlamydia trachomatis complete genome # ori <- oriloc() draw.oriloc(ori) # # The same, using more options from function draw.oriloc() # draw.oriloc(ori, main = expression(italic(Chlamydia~~trachomatis)~~complete~~genome), ta.mtext = "TA skew", ta.col = "red", cg.mtext = "CG skew", cg.col = "blue", cds.mtext = "CDS skew", cds.col = "seagreen", add.grid = FALSE) ## End(Not run)
Graphical representation for rearranged nucleotide skews in prokaryotic chromosomes.
draw.rearranged.oriloc(rearr.ori, breaks.gcfw = NA, breaks.gcrev = NA, breaks.atfw = NA, breaks.atrev = NA)draw.rearranged.oriloc(rearr.ori, breaks.gcfw = NA, breaks.gcrev = NA, breaks.atfw = NA, breaks.atrev = NA)
rearr.ori |
A data frame obtained with the |
breaks.gcfw |
The coordinates of the breakpoints in the GC-skew,
for forward transcribed protein coding sequences. These coordinates
can be obtained with the |
breaks.gcrev |
The coordinates of the breakpoints in the GC-skew,
for reverse transcribed protein coding sequences. These coordinates
can be obtained with the |
breaks.atfw |
The coordinates of the breakpoints in the AT-skew,
for forward transcribed protein coding sequences. These coordinates
can be obtained with the |
breaks.atrev |
The coordinates of the breakpoints in the AT-skew,
for reverse transcribed protein coding sequences. These coordinates
can be obtained with the |
J.R. Lobry, A. Necşulea
Necşulea, A. and Lobry, J.R. (2007) A New Method for Assessing the Effect of Replication on DNA Base Composition Asymmetry. Molecular Biology and Evolution, 24:2169-2179.
rearranged.oriloc,
extract.breakpoints
## Not run: ### Example for Chlamydia trachomatis #### ### Rearrange the chromosome and compute the nucleotide skews ### #r.ori <- rearranged.oriloc(seq.fasta = system.file("sequences/ct.fasta.gz", package = "seqinr"), # g2.coord = system.file("sequences/ct.coord", package = "seqinr")) r.ori <- rearranged.oriloc(seq.fasta = system.file("sequences/ct.fasta.gz", package = "seqinr"), g2.coord = system.file("sequences/ct.coord", package = "seqinr")) ### Extract the breakpoints for the rearranged nucleotide skews ### breaks <- extract.breakpoints(r.ori, type = c("gcfw", "gcrev"), nbreaks = c(2, 2), gridsize = 50, it.max = 100) ### Draw the rearranged nucleotide skews and ### ### place the position of the breakpoints on the graphics ### draw.rearranged.oriloc(r.ori, breaks.gcfw = breaks$gcfw$breaks, breaks.gcrev = breaks$gcrev$breaks) ## End(Not run)## Not run: ### Example for Chlamydia trachomatis #### ### Rearrange the chromosome and compute the nucleotide skews ### #r.ori <- rearranged.oriloc(seq.fasta = system.file("sequences/ct.fasta.gz", package = "seqinr"), # g2.coord = system.file("sequences/ct.coord", package = "seqinr")) r.ori <- rearranged.oriloc(seq.fasta = system.file("sequences/ct.fasta.gz", package = "seqinr"), g2.coord = system.file("sequences/ct.coord", package = "seqinr")) ### Extract the breakpoints for the rearranged nucleotide skews ### breaks <- extract.breakpoints(r.ori, type = c("gcfw", "gcrev"), nbreaks = c(2, 2), gridsize = 50, it.max = 100) ### Draw the rearranged nucleotide skews and ### ### place the position of the breakpoints on the graphics ### draw.rearranged.oriloc(r.ori, breaks.gcfw = breaks$gcfw$breaks, breaks.gcrev = breaks$gcrev$breaks) ## End(Not run)
This function displays the results returned by recstat with two plots. The
first one shows the factor scores of a CA computed on the codon composition of a DNA sequence.
The second one shows the locations of all Start and Stop codons in this sequence.
draw.recstat(rec, fac = 1, direct = TRUE, xlim = c(1, seqsize), col = c("red", "blue", "purple"))draw.recstat(rec, fac = 1, direct = TRUE, xlim = c(1, seqsize), col = c("red", "blue", "purple"))
rec |
list of elements returned by |
fac |
axis of the CA to use for display (4 |
direct |
a logical for the choice of direct or reverse strand. |
xlim |
starting and ending positions in the sequence for the plot. |
col |
vector of colour codes for the three frames of the sequence. |
The first plot shows the factor scores of the sliding windows, this for the three possible frames of the strand selected by the user. The second shows the Start (filled grey triangles pointing up) and Stop (solid black triangles pointing down) codons positions. Note that the standard genetic code is used for that purpose. Visual detection of putative CDS is performed through the simultaneous use of these two graphics. If a CDS is located within the sequence, the factor scores for the windows located in the corresponding reading frame will be significantly separated from the two others. Moreover, the region where this separation is seen should be located between a Start and a Stop codon.
O. Clerc, G. Perrière
test.li.recstat, test.co.recstat
ff <- system.file("sequences/ECOUNC.fsa", package = "seqinr") seq <- read.fasta(ff) rec <- recstat(seq[[1]], seqname = getName(seq)) draw.recstat(rec)ff <- system.file("sequences/ECOUNC.fsa", package = "seqinr") seq <- read.fasta(ff) rec <- recstat(seq[[1]], seqname = getName(seq)) draw.recstat(rec)
This dataset contains 999 coding sequences from the Escherichia coli chromosome
data(ec999)data(ec999)
List of 999 vectors of characters, one for each coding sequence.
chr [1:672] "A" "T" "G" "C" ...
chr [1:1749] "A" "T" "G" "C" ...
chr [1:681] "A" "T" "G" "A" ...
... TRUNCATED ...
chr [1:1116] "A" "T" "G" "G" ...
chr [1:1341] "A" "T" "G" "A" ...
chr [1:921] "A" "T" "G" "A" ...
Lobry, J.R., Gautier, C. (1994) Hydrophobicity, expressivity and aromaticity are the major trends of amino-acid usage in 999 Escherichia coli chromosome-encode genes. Nucleic Acids Research,22:3174-3180.
citation("seqinr")
data(ec999) # # How to export sequences in a FASTA file: # fname <- tempfile(pattern = "ecc999", tmpdir = tempdir(), fileext = "ffn") tempdir(check = FALSE) write.fasta(ec999, names(ec999), file = fname)data(ec999) # # How to export sequences in a FASTA file: # fname <- tempfile(pattern = "ecc999", tmpdir = tempdir(), fileext = "ffn") tempdir(check = FALSE) write.fasta(ec999, names(ec999), file = fname)
This is an example of allelic ladder raw data for a human STR genetic profile at 16 loci (viz. D8S1179, D21S11, D7S820, CSF1PO, D3S1358, TH01, D13S317, D16S539, D2S1338, D19S433, vWA, TPOX, D18S51, Amelogenin, D5S818, FGA) which are commonly used in forensic sciences for individual identifications.
data(ECH)data(ECH)
A list with 3 components as in JLO
J.R. Lobry
Data were kindly provided by the INPS (Institut National de Police Scientifique) which is the national forensic sciences institute in France. Experiments were done at the LPS (Laboratoire de Police Scientifique de Lyon) in 2008.
citation("seqinr")
Anonymous (2006) Applied Biosystem Genetic Analysis Data File Format. Available at https://www.thermofisher.com/de/de/home/brands/applied-biosystems.html. Last visited on 03-NOV-2008.
function read.abif to import files in ABIF format,
data gs500liz for internal size standards,
data identifiler for allele names in the allelic ladder,
data JLO for an example of an individual sample file.
data(JLO)data(JLO)
This dataset is used to compute linear forms on codon frequencies:
if codfreq is a vector of codon frequencies then
drop(freq %*% EXP$CG3) will return for instance the G+C content
in third codon positions. Base order is the lexical order: a,
c, g, t (or u).
data(EXP)data(EXP)
List of 24 vectors of coefficients
num [1:4] 1 0 0 0
num [1:64] 1 0 0 0 1 0 0 0 1 0 ...
num [1:64] 0 0 0 0 0 0 0 0 1 0 ...
num [1:64] 0 0 0 0 0 0 0 0 1 0 ...
num [1:64] 1 0 0 1 1 0 0 1 1 0 ...
num [1:64] 0 1 0 0 0 0 0 0 0 0 ...
num [1:4] 0 1 0 0
num [1:64] 0 1 0 0 0 1 0 0 0 1 ...
num [1:64] 0.00 0.00 -1.37 -2.98 -2.58 ...
num [1:4] 0 1 1 0
num [1:64] 0 0 0 0 0 0 0 0 0 0 ...
num [1:64] 0 0 0 0 0.5 0.5 0.5 0.5 0.5 0.5 ...
num [1:64] 0 0 0 0 1 1 1 1 1 1 ...
num [1:64] 0 1 1 0 0 1 1 0 0 1 ...
num [1:64] 0 0 0 0 0 0 0 0 0 0 ...
num [1:64] 1.026 0.239 1.026 0.239 -0.097 ...
num [1:4] 0 0 1 0
num [1:64] 0 0 1 0 0 0 1 0 0 0 ...
num [1:64] -3.9 -3.5 -3.9 -3.5 -0.7 -0.7 -0.7 -0.7 -4.5 -0.8 ...
num [1:64] 0 0 0 0 1 1 1 1 0 0 ...
num [1:64] 0 0 0 0 1 0 0 0 0 0 ...
num [1:64] 0 0 0 0 0 1 0 0 0 0 ...
num [1:4] 0 0 0 1
num [1:64] 0 0 0 1 0 0 0 1 0 0 ...
It's better to work directly at the amino-acid level
when computing linear forms on amino-acid frequencies so as to have
a single coefficient vector. For instance EXP$KD to compute the Kyte
and Doolittle hydrophaty index from codon frequencies is valid only
for the standard genetic code.
An alternative for drop(freq %*% EXP$CG3) is
sum( freq * EXP$CG3 ), but this is less efficient in terms of CPU
time. The advantage of the latter, however, is that thanks to
recycling rules you can use either sum( freq * EXP$A )
or sum( freq * EXP$A3 ). To do the same with the %*%
operator you have to explicit the recycling rule as in
drop( freq %*% rep(EXP$A, 16)).
citation("seqinr")
content in A nucleotide
content in A nucleotide in third position of codon
Arg content (aga and agg codons)
Arg content
content in A and U nucleotides in third position of codon
Good choice (Bon choix). Gouy M., Gautier C. (1982) codon usage in bacteria : Correlation with gene expressivity. Nucleic Acids Research,10(22):7055-7074.
content in C nucleotides
content in A nucleotides in third position of codon
Codon adaptation index for E. coli. Sharp, P.M., Li, W.-H. (1987) The codon adaptation index - a measure of directionam synonymous codon usage bias, and its potential applications. Nucleic Acids Research,15:1281-1295.
content in G + C nucleotides
content in G + C nucleotides in first position of codon
content in G + C nucleotides in first and second position of codon
content in G + C nucleotides in second position of codon
content in G + C nucleotides in third position of codon
content in CGA + CGU + CGA + CGG
From Table 2 in Lobry, J.R., Gautier, C. (1994) Hydrophobicity, expressivity and aromaticity are the major trends of amino-acid usage in 999 Escherichia coli chromosome-encode genes. Nucleic Acids Research,22:3174-3180.
content in G nucleotides in third position of codon
Kyte, J., Doolittle, R.F. (1982) A simple method for displaying the hydropathic character of a protein. J. Mol. Biol.,157 :105-132.
content in quartet
content in quartet with the A nucleotide in third position
content in quartet with the A nucleotide in third position
content in U nucleotide
content in U nucleotides in third position of codon
data(EXP)data(EXP)
Extraction of breakpoint positions on the rearranged nucleotide skews.
extract.breakpoints(rearr.ori, type = c("atfw", "atrev", "gcfw", "gcrev"), nbreaks, gridsize = 100, it.max = 500)extract.breakpoints(rearr.ori, type = c("atfw", "atrev", "gcfw", "gcrev"), nbreaks, gridsize = 100, it.max = 500)
rearr.ori |
A data frame obtained with the |
type |
The type of skew for which to extract the breakpoints; must
be a subset of |
nbreaks |
The number of breakpoints to extract for each type of
skew. Provide a vector of the same length as |
gridsize |
To make sure that the best breakpoints are found, and to
avoid finding only a local extremum of the likelihood and residual sum
of square functions, a grid search is performed. The search for
breakpoints is repeated |
it.max |
The maximum number of iterations to be performed when
searching for the breakpoints. This argument corresponds to the
|
This method uses the segmented function in the segmented
package to extract the breakpoints positions in the rearranged
nucleotide skews obtained with the rearranged.oriloc function.
To make sure that the best breakpoints are found, and to
avoid finding only a local extremum of the likelihood and residual sum
of square functions, a grid search is performed. The search for
breakpoints is repeated gridsize times, with different starting
values for the breakpoints.
This function returns a list, with as many elements as the type
argument (for example $gcfw will contain the results for the
rearranged GC-skew, for forward-encoded genes). Each element of this list is also a list, containing the
following information: in $breaks the position of the breakpoints on the
rearranged chromosome; in $slopes.left the slopes of the
segments on the left side of each breakpoint; in $slopes.right the slopes of the
segments on the right side of each breakpoint; in $real.coord,
the coordinates of the breakpoints on the real chromosome (before rearrangement).
A. Necşulea
citation("segmented")
Necşulea, A. and Lobry, J.R. (in prep) A novel method for assessing the effect of replication on DNA base composition asymmetry. Molecular Biology and Evolution,24:2169-2179.
oriloc, draw.rearranged.oriloc,
rearranged.oriloc
### Example for Chlamydia trachomatis #### ### Rearrange the chromosome and compute the nucleotide skews ### ## Not run: r.ori <- rearranged.oriloc(seq.fasta = system.file("sequences/ct.fasta.gz", package = "seqinr"), g2.coord = system.file("sequences/ct.coord",package = "seqinr")) ## End(Not run) ### Extract the breakpoints for the rearranged nucleotide skews ### ## Not run: breaks <- extract.breakpoints(r.ori,type = c("gcfw", "gcrev"), nbreaks = c(2, 2), gridsize = 50, it.max = 100) ## End(Not run) ### Draw the rearranged nucleotide skews and ### ### place the position of the breakpoints on the graphics ### ## Not run: draw.rearranged.oriloc(r.ori, breaks.gcfw = breaks$gcfw$breaks, breaks.gcrev = breaks$gcrev$breaks) ## End(Not run)### Example for Chlamydia trachomatis #### ### Rearrange the chromosome and compute the nucleotide skews ### ## Not run: r.ori <- rearranged.oriloc(seq.fasta = system.file("sequences/ct.fasta.gz", package = "seqinr"), g2.coord = system.file("sequences/ct.coord",package = "seqinr")) ## End(Not run) ### Extract the breakpoints for the rearranged nucleotide skews ### ## Not run: breaks <- extract.breakpoints(r.ori,type = c("gcfw", "gcrev"), nbreaks = c(2, 2), gridsize = 50, it.max = 100) ## End(Not run) ### Draw the rearranged nucleotide skews and ### ### place the position of the breakpoints on the graphics ### ## Not run: draw.rearranged.oriloc(r.ori, breaks.gcfw = breaks$gcfw$breaks, breaks.gcrev = breaks$gcrev$breaks) ## End(Not run)
The function allows to extract large amount of data as whole genome sequences,using different output formats and types of extraction. This function is not yet available for windows in zlib mode.
extractseqs(listname,socket = autosocket(), format="fasta", operation="simple",feature="xx", bounds="xx", minbounds="xx", verbose = FALSE, nzlines=1000, zlib = FALSE) exseq(listname,socket = autosocket(), format="fasta",operation="simple", feature="xx", bounds="xx", minbounds="xx", verbose = FALSE, nzlines=1000, zlib = FALSE)extractseqs(listname,socket = autosocket(), format="fasta", operation="simple",feature="xx", bounds="xx", minbounds="xx", verbose = FALSE, nzlines=1000, zlib = FALSE) exseq(listname,socket = autosocket(), format="fasta",operation="simple", feature="xx", bounds="xx", minbounds="xx", verbose = FALSE, nzlines=1000, zlib = FALSE)
listname |
the name of list on server (may be a virtual list) |
socket |
an object of class |
format |
the format of output.Can be |
operation |
the type of extraction. Can be |
feature |
-optional- the feature to be extracted (for operations "feature" or "region"): a feature table item (CDS, mRNA,...) |
bounds |
-optional- the bounds for extraction (for operations "fragment" or "region") |
minbounds |
-optional- the minimal bounds for extraction (for operations "fragment" or "region") |
verbose |
if |
nzlines |
number of line in zlib mode |
zlib |
logical. If TRUE sequences are download in zlib compress mode. |
To extract a list of sequences (lrank argument) or a single sequence (seqnum argument) using different output formats and types of extraction. All formats except "coordinates" extract sequence data. Format "coordinates" extract coordinate data; start > end indicates the complementary strand.
sequence list name.
a socket of class connection and sockconn returned by choosebank.
Default value (auto) means that the socket will be set to to the socket component of the banknameSocket variable.
acnuc, fasta, flat or coordinates
simple, translate, fragment, feature or region
(for operations "feature" or "region") a feature table item (CDS, mRNA,...).
each sequence or subsequence is extracted.
meaningful only for protein-coding (sub)sequences that are extracted as protein sequences. Nothing is extracted for non-protein coding sequences.
Allows to extract any part of the sequence(s) in list. Such part is specified by the bounds and minbounds arguments according to the syntax suggested by these examples:
| 132,1600 | to extract from nucl. 132 to nucl 1600 of the sequence. If applied to a subsequence, coordinates are in the parent seq relatively to the subsequence start point. | |
| -10,10 | to extract from 10 nucl. BEFORE the 5' end of the sequence to nucl. 10 of it. Useful only for subsequences, and produces a fragment extracted from its parent sequence. | |
| e-20,e+10 | to extract from 20 nucl. BEFORE the 3' end of the sequence to 10 nucl. AFTER its 3' end. Useful only for subsequences, and produces a fragment extracted from its parent sequence. | |
| -20,e+5 | to extract from 20 nucl. BEFORE the 5' end of the sequence to 5 nucl. AFTER its 3' end. |
(for operations "fragment" or "region") see syntax above.
same syntax as bounds. When the sequence data is too short for this quantity to be extracted, nothing is extracted. When the sequence data is between minbounds and bounds, extracted sequence data is extended by N's to the desired length.
Sequence data.
S. Penel
citation("seqinr")
## Not run: # Need internet connection choosebank("emblTP") mylist <- query("mylist", "k=globin", virtual = TRUE) mylist.fasta <- exseq("mylist", verbose = TRUE) # 103 lines of FASTA stopifnot(length(mylist.fasta) == 103) closebank() ## End(Not run)## Not run: # Need internet connection choosebank("emblTP") mylist <- query("mylist", "k=globin", virtual = TRUE) mylist.fasta <- exseq("mylist", verbose = TRUE) # 103 lines of FASTA stopifnot(length(mylist.fasta) == 103) closebank() ## End(Not run)
This data set gives an example of a amino acids alignment obtained after a call to the function read.alignment on an alignment file in "fasta" format.
data(fasta)data(fasta)
A List of class alignment
https://pbil.univ-lyon1.fr/help/formats.html/
Pearson W.R. and Lipman D.J. (1988) Improved tools for biological sequence comparison..Proc Natl Acad Sci U S A. 85(8):2444-8.
The purpose of this function is to compute as fast as possible the number of allele in common between a target (typically the genetic profile observed at a crime scene, possibly a mixture with dropouts) and a database reference (typically genetic profile of individuals). Both are assumed to be pre-encoded at the bit level in a consistent way.
fastacc(target, database)fastacc(target, database)
target |
the |
database |
the |
This function is an RFC state. Comments are welcome.
Genetic profiles are encoded at the bit level. One bit represents one allele.
Count is based on a logical AND at bit level. Bit count is encoded at C level
using the precomputed approach: one indirection with an auxiliary table
of size 256 called bits_in_char which is pre-computed at R level and
passed at C level.
A vector of integer giving for each entry in the database how many
alleles are in common between the entry and the target.
Experimental, first release schedulded for seqinr 2.0-6 by the end of 2009
J.R. Lobry
citation("seqinr")
FIXME
# # NOTE: # # This example section is a proof-of-concept stuff. Most code should be # enbeded in documented functions to avoid verbosity. But at the RFC stage # this is perhaps not a too bad idea to show how powerfull R is. # # # Let's start from the 16 loci available in the AmpFLSTR kit: # path <- system.file("abif/AmpFLSTR_Bins_v1.txt", package = "seqinr") resbin <- readBins(path) codis <- resbin[["Identifiler_CODIS_v1"]] names(codis) # # We count how many different alleles are present per locus: # na <- unlist(lapply(codis, function(x) length(x[[1]]))) na # # The number of octets required to encode a genetic for each locus is then: # ceiling(na/8) # # We need then a total of 40 octets to code these profiles: # sum(ceiling(na/8)) # # Let's definene a function to encode a profile at a given locus, and vice versa : # prof2raw <- function(profile, alleles) { if (!is.ordered(alleles)) stop("ordered factor expected for alleles") if (!is.character(profile)) stop("vector of character expected for profile") noctets <- ceiling(length(alleles)/8) res.b <- rawToBits(raw(noctets)) for (i in 1:length(profile)) { res.b[which(profile[i] == alleles)] <- as.raw(1) } return(packBits(res.b, type = "raw")) } raw2prof <- function(rawdata, alleles) { if (!is.ordered(alleles)) stop("ordered factor expected for alleles") if (!is.raw(rawdata)) stop("vector of raw expected for rawdata") res <- as.character(alleles)[as.logical(rawToBits(rawdata))] return(paste(res, collapse = ", ")) } # # Let now code all alleles present in codis as ordered factors: # allalleles <- lapply(codis, function(x) factor(x[, 1], levels = x[, 1], ordered = TRUE)) # # Let's play with our encoding/decoding utilities with first locus: # allalleles[[1]] # <8 8 9 10 11 12 13 14 15 16 17 18 19 >19 res <- prof2raw(c("8", "9", "13", "14", ">19"), allalleles[[1]]) res # c6 20 rawToBits(res) # 00 01 01 00 00 00 01 01 00 00 00 00 00 01 00 00 raw2prof(res, allalleles[[1]]) # "8, 9, 13, 14, >19" # # Let define a profile with all possible alleles: # ladder <- unlist(lapply(allalleles, function(x) prof2raw(as.character(x),x))) names(ladder) <- NULL stopifnot(identical(as.integer(ladder), c(255L, 63L, 255L, 255L, 255L, 63L, 255L, 63L, 255L, 31L, 255L, 63L, 255L, 255L, 7L, 255L, 3L, 255L, 63L, 255L, 255L, 255L, 255L, 15L, 255L, 127L, 255L, 3L, 255L, 255L, 255L, 255L, 3L, 3L, 255L, 15L, 255L, 255L, 255L, 7L))) # simple sanity check # # Let's make a simulated database. Here we use a random sampling # with a uniform distribution between all possible profile possible # at a given locus. A more realist sampling for an individual database # would be to sample only two alleles at each locus according to # observed frequencies in populations. # n <- 10^5 # the number of records in the database DB <- sapply(ladder, function(x) as.raw(sample(0:as.integer(x), size = n, replace = TRUE))) # # Now we make sure that the target is in the database: # target <- DB[666, ] DB <- as.vector(t(DB)) # put DB as a flat database (is it usefull?) # # Now we compute the number of alleles in common between the # target and all the entries in the DB: # system.time(res <- fastacc(target,DB)) # Fast, isn't it ? stopifnot(which.max(res) == 666) # sanity check # # Don't run : too tedious for routine check. We check here that complexity is # linear in time up to a 10 10^6 database size (roughly the size of individual # profiles at the EU level) # ## Not run: maxn <- 10^7 DB <- sapply(ladder, function(x) as.raw(sample(0:as.integer(x), size = maxn, replace = T))) target <- DB[666, ] DB <- as.vector(t(DB)) np <- 10 nseq <- seq(from = 10^5, to = maxn, length = np) res <- numeric(np) i <- 1 for (n in nseq) { print(i) res[i] <- system.time(tmp <- fastacc(target, DB[1:n]))[1] stopifnot(which.max(tmp) == 666) i <- i + 1 } dbse <- data.frame(list(nseq = nseq, res = res)) x <- dbse$nseq y <- dbse$res plot(x, y, type = "b", xlab = "Number of entries in DB", ylab = "One query time [s]", las = 1, xlim = c(0, maxn), ylim = c(0, max(y)), main = "Data base size effect on query time") lm1 <- lm(y ~ x - 1) abline(lm1, col = "red") legend("topleft", inset = 0.01, legend = paste("y =", formatC(lm1$coef[1], digits = 3), "x"), col = "red", lty = 1) # # On my laptop the slope is 2.51e-08, that is a 1/4 of second to scan a database # with 10 10^6 entries. # ## End(Not run) ## end# # NOTE: # # This example section is a proof-of-concept stuff. Most code should be # enbeded in documented functions to avoid verbosity. But at the RFC stage # this is perhaps not a too bad idea to show how powerfull R is. # # # Let's start from the 16 loci available in the AmpFLSTR kit: # path <- system.file("abif/AmpFLSTR_Bins_v1.txt", package = "seqinr") resbin <- readBins(path) codis <- resbin[["Identifiler_CODIS_v1"]] names(codis) # # We count how many different alleles are present per locus: # na <- unlist(lapply(codis, function(x) length(x[[1]]))) na # # The number of octets required to encode a genetic for each locus is then: # ceiling(na/8) # # We need then a total of 40 octets to code these profiles: # sum(ceiling(na/8)) # # Let's definene a function to encode a profile at a given locus, and vice versa : # prof2raw <- function(profile, alleles) { if (!is.ordered(alleles)) stop("ordered factor expected for alleles") if (!is.character(profile)) stop("vector of character expected for profile") noctets <- ceiling(length(alleles)/8) res.b <- rawToBits(raw(noctets)) for (i in 1:length(profile)) { res.b[which(profile[i] == alleles)] <- as.raw(1) } return(packBits(res.b, type = "raw")) } raw2prof <- function(rawdata, alleles) { if (!is.ordered(alleles)) stop("ordered factor expected for alleles") if (!is.raw(rawdata)) stop("vector of raw expected for rawdata") res <- as.character(alleles)[as.logical(rawToBits(rawdata))] return(paste(res, collapse = ", ")) } # # Let now code all alleles present in codis as ordered factors: # allalleles <- lapply(codis, function(x) factor(x[, 1], levels = x[, 1], ordered = TRUE)) # # Let's play with our encoding/decoding utilities with first locus: # allalleles[[1]] # <8 8 9 10 11 12 13 14 15 16 17 18 19 >19 res <- prof2raw(c("8", "9", "13", "14", ">19"), allalleles[[1]]) res # c6 20 rawToBits(res) # 00 01 01 00 00 00 01 01 00 00 00 00 00 01 00 00 raw2prof(res, allalleles[[1]]) # "8, 9, 13, 14, >19" # # Let define a profile with all possible alleles: # ladder <- unlist(lapply(allalleles, function(x) prof2raw(as.character(x),x))) names(ladder) <- NULL stopifnot(identical(as.integer(ladder), c(255L, 63L, 255L, 255L, 255L, 63L, 255L, 63L, 255L, 31L, 255L, 63L, 255L, 255L, 7L, 255L, 3L, 255L, 63L, 255L, 255L, 255L, 255L, 15L, 255L, 127L, 255L, 3L, 255L, 255L, 255L, 255L, 3L, 3L, 255L, 15L, 255L, 255L, 255L, 7L))) # simple sanity check # # Let's make a simulated database. Here we use a random sampling # with a uniform distribution between all possible profile possible # at a given locus. A more realist sampling for an individual database # would be to sample only two alleles at each locus according to # observed frequencies in populations. # n <- 10^5 # the number of records in the database DB <- sapply(ladder, function(x) as.raw(sample(0:as.integer(x), size = n, replace = TRUE))) # # Now we make sure that the target is in the database: # target <- DB[666, ] DB <- as.vector(t(DB)) # put DB as a flat database (is it usefull?) # # Now we compute the number of alleles in common between the # target and all the entries in the DB: # system.time(res <- fastacc(target,DB)) # Fast, isn't it ? stopifnot(which.max(res) == 666) # sanity check # # Don't run : too tedious for routine check. We check here that complexity is # linear in time up to a 10 10^6 database size (roughly the size of individual # profiles at the EU level) # ## Not run: maxn <- 10^7 DB <- sapply(ladder, function(x) as.raw(sample(0:as.integer(x), size = maxn, replace = T))) target <- DB[666, ] DB <- as.vector(t(DB)) np <- 10 nseq <- seq(from = 10^5, to = maxn, length = np) res <- numeric(np) i <- 1 for (n in nseq) { print(i) res[i] <- system.time(tmp <- fastacc(target, DB[1:n]))[1] stopifnot(which.max(tmp) == 666) i <- i + 1 } dbse <- data.frame(list(nseq = nseq, res = res)) x <- dbse$nseq y <- dbse$res plot(x, y, type = "b", xlab = "Number of entries in DB", ylab = "One query time [s]", las = 1, xlim = c(0, maxn), ylim = c(0, max(y)), main = "Data base size effect on query time") lm1 <- lm(y ~ x - 1) abline(lm1, col = "red") legend("topleft", inset = 0.01, legend = paste("y =", formatC(lm1$coef[1], digits = 3), "x"), col = "red", lty = 1) # # On my laptop the slope is 2.51e-08, that is a 1/4 of second to scan a database # with 10 10^6 entries. # ## End(Not run) ## end
Calculates the fraction of G+C bases of the input nucleic acid
sequence(s). It reads in nucleic acid sequences, sums the number of
'g' and 'c' bases and writes out the result as the fraction (in the
interval 0.0 to 1.0) to the total number of 'a', 'c', 'g' and 't' bases.
Global G+C content GC, G+C in the first position of the codon bases
GC1, G+C in the second position of the codon bases
GC2, and G+C in the third position of the codon bases
GC3 can be computed. All functions can take ambiguous bases
into account when requested.
GC(seq, forceToLower = TRUE, exact = FALSE, NA.GC = NA, oldGC = FALSE, alphabet = s2c("acgtswmkryvhdb")) GC1(seq, frame = 0, ...) GC2(seq, frame = 0, ...) GC3(seq, frame = 0, ...) GCpos(seq, pos, frame = 0, ...)GC(seq, forceToLower = TRUE, exact = FALSE, NA.GC = NA, oldGC = FALSE, alphabet = s2c("acgtswmkryvhdb")) GC1(seq, frame = 0, ...) GC2(seq, frame = 0, ...) GC3(seq, frame = 0, ...) GCpos(seq, pos, frame = 0, ...)
seq |
a nucleic acid sequence as a vector of single characters |
frame |
for coding sequences, an integer (0, 1, 2) giving the frame |
forceToLower |
logical. if |
exact |
logical: if |
NA.GC |
what should be returned when the GC is impossible to
compute from data, for instance with NNNNNNN. This behaviour could
be different when argument |
... |
arguments passed to the function |
pos |
for coding sequences, the codon position (1, 2, 3) that should be taken into account to compute the G+C content |
oldGC |
logical defaulting to |
alphabet |
alphabet used. This allows you to choose ambiguous bases used during GC calculation. |
When exact is set to TRUE the G+C content is estimated
with ambiguous bases taken into account. Note that this is time expensive.
A first pass is made on non-ambiguous bases to estimate the probabilities
of the four bases in the sequence. They are then used to weight the
contributions of ambiguous bases to the G+C content. Let note nx
the total number of base 'x' in the sequence. For instance
suppose that there are nb bases 'b'. 'b' stands for "not a", that
is for 'c', 'g' or 't'. The contribution of 'b' bases to the GC base
count will be:
nb*(nc + ng)/(nc + ng + nt)
The contribution of 'b' bases to the AT base count will be:
nb*nt/(nc + ng + nt)
All ambiguous bases contributions to the AT and GC counts are weighted is similar way and then the G+C content is computed as ngc/(nat + ngc).
GC returns the fraction of G+C (in [0,1]) as a numeric vector of length one.
GCpos returns GC at position pos.
GC1, GC2, GC3 are wrappers for GCpos with the
argument pos set to 1, 2, and 3, respectively.
NA is returned when seq is NA.
NA.GC defaulting to NA is returned when the G+C content
can not be computed from data.
D. Charif, L. Palmeira, J.R. Lobry
citation("seqinr").
The program codonW used here for comparison is available at https://codonw.sourceforge.net/.
You can use s2c to convert a string into a vetor of single
character and tolower to convert upper-case characters into
lower-case characters. Do not confuse with gc for garbage collection.
mysequence <- s2c("agtctggggggccccttttaagtagatagatagctagtcgta") GC(mysequence) # 0.4761905 GC1(mysequence) # 0.6428571 GC2(mysequence) # 0.3571429 GC3(mysequence) # 0.4285714 # # With upper-case characters: # myUCsequence <- s2c("GGGGGGGGGA") GC(myUCsequence) # 0.9 # # With ambiguous bases: # GC(s2c("acgt")) # 0.5 GC(s2c("acgtssss")) # 0.5 GC(s2c("acgtssss"), exact = TRUE) # 0.75 # # Missing data: # stopifnot(is.na(GC(s2c("NNNN")))) stopifnot(is.na(GC(s2c("NNNN"), exact = TRUE))) stopifnot(is.na(GC(s2c("WWSS")))) stopifnot(GC(s2c("WWSS"), exact = TRUE) == 0.5) # # Coding sequences tests: # cdstest <- s2c("ATGATG") stopifnot(GC3(cdstest) == 1) stopifnot(GC2(cdstest) == 0) stopifnot(GC1(cdstest) == 0) # # How to reproduce the results obtained with the C program codonW # version 1.4.4 writen by John Peden. We use here the "input.dat" # test file from codonW (there are no ambiguous base in these # sequences). # inputdatfile <- system.file("sequences/input.dat", package = "seqinr") input <- read.fasta(file = inputdatfile) # read the FASTA file inputoutfile <- system.file("sequences/input.out", package = "seqinr") input.res <- read.table(inputoutfile, header = TRUE) # read codonW result file # # remove stop codon before computing G+C content (as in codonW) # GC.codonW <- function(dnaseq, ...){ GC(dnaseq[seq_len(length(dnaseq) - 3)], ...) } input.gc <- sapply(input, GC.codonW, forceToLower = FALSE) max(abs(input.gc - input.res$GC)) # 0.0004946237 plot(x = input.gc, y = input.res$GC, las = 1, xlab = "Results with GC()", ylab = "Results from codonW", main = "Comparison of G+C content results") abline(c(0, 1), col = "red") legend("topleft", inset = 0.01, legend = "y = x", lty = 1, col = "red") ## Not run: # Too long for routine check # This is a benchmark to compare the effect of various parameter # setting on computation time n <- 10 from <-10^4 to <- 10^5 size <- seq(from = from, to = to, length = n) res <- data.frame(matrix(NA, nrow = n, ncol = 5)) colnames(res) <- c("size", "FF", "FT", "TF", "TT") res[, "size"] <- size for(i in seq_len(n)){ myseq <- sample(x = s2c("acgtws"), size = size[i], replace = TRUE) res[i, "FF"] <- system.time(GC(myseq, forceToLower = FALSE, exact = FALSE))[3] res[i, "FT"] <- system.time(GC(myseq, forceToLower = FALSE, exact = TRUE))[3] res[i, "TF"] <- system.time(GC(myseq, forceToLower = TRUE, exact = FALSE))[3] res[i, "TT"] <- system.time(GC(myseq, forceToLower = TRUE, exact = TRUE))[3] } par(oma = c(0,0,2.5,0), mar = c(4,5,0,2) + 0.1, mfrow = c(2, 1)) plot(res$size, res$TT, las = 1, xlab = "Sequence size [bp]", ylim = c(0, max(res$TT)), xlim = c(0, max(res$size)), ylab = "") title(ylab = "Observed time [s]", line = 4) abline(lm(res$TT~res$size)) points(res$size, res$FT, col = "red") abline(lm(res$FT~res$size), col = "red", lty = 3) points(res$size, res$TF, pch = 2) abline(lm(res$TF~res$size)) points(res$size, res$FF, pch = 2, col = "red") abline(lm(res$FF~res$size), lty = 3, col = "red") legend("topleft", inset = 0.01, legend = c("forceToLower = TRUE", "forceToLower = FALSE"), col = c("black", "red"), lty = c(1,3)) legend("bottomright", inset = 0.01, legend = c("exact = TRUE", "exact = FALSE"), pch = c(1,2)) mincpu <- lm(res$FF~res$size)$coef[2] barplot( c(lm(res$FF~res$size)$coef[2]/mincpu, lm(res$TF~res$size)$coef[2]/mincpu, lm(res$FT~res$size)$coef[2]/mincpu, lm(res$TT~res$size)$coef[2]/mincpu), horiz = TRUE, xlab = "Increase of CPU time", col = c("red", "black", "red", "black"), names.arg = c("(F,F)", "(T,F)", "(F,T)", "(T,T)"), las = 1) title(ylab = "forceToLower,exact", line = 4) mtext("CPU time as function of options", outer = TRUE, line = 1, cex = 1.5) ## End(Not run)mysequence <- s2c("agtctggggggccccttttaagtagatagatagctagtcgta") GC(mysequence) # 0.4761905 GC1(mysequence) # 0.6428571 GC2(mysequence) # 0.3571429 GC3(mysequence) # 0.4285714 # # With upper-case characters: # myUCsequence <- s2c("GGGGGGGGGA") GC(myUCsequence) # 0.9 # # With ambiguous bases: # GC(s2c("acgt")) # 0.5 GC(s2c("acgtssss")) # 0.5 GC(s2c("acgtssss"), exact = TRUE) # 0.75 # # Missing data: # stopifnot(is.na(GC(s2c("NNNN")))) stopifnot(is.na(GC(s2c("NNNN"), exact = TRUE))) stopifnot(is.na(GC(s2c("WWSS")))) stopifnot(GC(s2c("WWSS"), exact = TRUE) == 0.5) # # Coding sequences tests: # cdstest <- s2c("ATGATG") stopifnot(GC3(cdstest) == 1) stopifnot(GC2(cdstest) == 0) stopifnot(GC1(cdstest) == 0) # # How to reproduce the results obtained with the C program codonW # version 1.4.4 writen by John Peden. We use here the "input.dat" # test file from codonW (there are no ambiguous base in these # sequences). # inputdatfile <- system.file("sequences/input.dat", package = "seqinr") input <- read.fasta(file = inputdatfile) # read the FASTA file inputoutfile <- system.file("sequences/input.out", package = "seqinr") input.res <- read.table(inputoutfile, header = TRUE) # read codonW result file # # remove stop codon before computing G+C content (as in codonW) # GC.codonW <- function(dnaseq, ...){ GC(dnaseq[seq_len(length(dnaseq) - 3)], ...) } input.gc <- sapply(input, GC.codonW, forceToLower = FALSE) max(abs(input.gc - input.res$GC)) # 0.0004946237 plot(x = input.gc, y = input.res$GC, las = 1, xlab = "Results with GC()", ylab = "Results from codonW", main = "Comparison of G+C content results") abline(c(0, 1), col = "red") legend("topleft", inset = 0.01, legend = "y = x", lty = 1, col = "red") ## Not run: # Too long for routine check # This is a benchmark to compare the effect of various parameter # setting on computation time n <- 10 from <-10^4 to <- 10^5 size <- seq(from = from, to = to, length = n) res <- data.frame(matrix(NA, nrow = n, ncol = 5)) colnames(res) <- c("size", "FF", "FT", "TF", "TT") res[, "size"] <- size for(i in seq_len(n)){ myseq <- sample(x = s2c("acgtws"), size = size[i], replace = TRUE) res[i, "FF"] <- system.time(GC(myseq, forceToLower = FALSE, exact = FALSE))[3] res[i, "FT"] <- system.time(GC(myseq, forceToLower = FALSE, exact = TRUE))[3] res[i, "TF"] <- system.time(GC(myseq, forceToLower = TRUE, exact = FALSE))[3] res[i, "TT"] <- system.time(GC(myseq, forceToLower = TRUE, exact = TRUE))[3] } par(oma = c(0,0,2.5,0), mar = c(4,5,0,2) + 0.1, mfrow = c(2, 1)) plot(res$size, res$TT, las = 1, xlab = "Sequence size [bp]", ylim = c(0, max(res$TT)), xlim = c(0, max(res$size)), ylab = "") title(ylab = "Observed time [s]", line = 4) abline(lm(res$TT~res$size)) points(res$size, res$FT, col = "red") abline(lm(res$FT~res$size), col = "red", lty = 3) points(res$size, res$TF, pch = 2) abline(lm(res$TF~res$size)) points(res$size, res$FF, pch = 2, col = "red") abline(lm(res$FF~res$size), lty = 3, col = "red") legend("topleft", inset = 0.01, legend = c("forceToLower = TRUE", "forceToLower = FALSE"), col = c("black", "red"), lty = c(1,3)) legend("bottomright", inset = 0.01, legend = c("exact = TRUE", "exact = FALSE"), pch = c(1,2)) mincpu <- lm(res$FF~res$size)$coef[2] barplot( c(lm(res$FF~res$size)$coef[2]/mincpu, lm(res$TF~res$size)$coef[2]/mincpu, lm(res$FT~res$size)$coef[2]/mincpu, lm(res$TT~res$size)$coef[2]/mincpu), horiz = TRUE, xlab = "Increase of CPU time", col = c("red", "black", "red", "black"), names.arg = c("(F,F)", "(T,F)", "(F,T)", "(T,T)"), las = 1) title(ylab = "forceToLower,exact", line = 4) mtext("CPU time as function of options", outer = TRUE, line = 1, cex = 1.5) ## End(Not run)
Converts a single entry in GenBank format into a fasta file.
gb2fasta(source.file, destination.file)gb2fasta(source.file, destination.file)
source.file |
GenBank file |
destination.file |
Fasta file |
Multiple entries in GenBank file are not supported.
none
J.R. Lobry
citation("seqinr")
myGenBankFile <- system.file("sequences/ct.gbk.gz", package = "seqinr") #myFastaFileName <- "Acinetobacter_ADP1_uid61597.fasta" myFastaFileName <-tempfile(pattern = "Acinetobacter_ADP1_uid61597", tmpdir = tempdir(), fileext = "fasta") tempdir(check = FALSE) gb2fasta(myGenBankFile, myFastaFileName) readLines(myFastaFileName)[1:5] # # Should be : # # [1] ">CHLTCG 1042519 bp" # [2] "gcggccgcccgggaaattgctaaaagatgggagcaaagagttagagatctacaagataaa" # [3] "ggtgctgcacgaaaattattaaatgatcctttaggccgacgaacacctaattatcagagc" # [4] "aaaaatccaggtgagtatactgtagggaattccatgttttacgatggtcctcaggtagcg" # [5] "aatctccagaacgtcgacactggtttttggctggacatgagcaatctctcagacgttgta" #myGenBankFile <- system.file("sequences/ct.gbk.gz", package = "seqinr") #myFastaFileName <- "Acinetobacter_ADP1_uid61597.fasta" myFastaFileName <-tempfile(pattern = "Acinetobacter_ADP1_uid61597", tmpdir = tempdir(), fileext = "fasta") tempdir(check = FALSE) gb2fasta(myGenBankFile, myFastaFileName) readLines(myFastaFileName)[1:5] # # Should be : # # [1] ">CHLTCG 1042519 bp" # [2] "gcggccgcccgggaaattgctaaaagatgggagcaaagagttagagatctacaagataaa" # [3] "ggtgctgcacgaaaattattaaatgatcctttaggccgacgaacacctaattatcagagc" # [4] "aaaaatccaggtgagtatactgtagggaattccatgttttacgatggtcctcaggtagcg" # [5] "aatctccagaacgtcgacactggtttttggctggacatgagcaatctctcagacgttgta" #
This function reads a file in GenBank format and converts the features corresponding to CDS (Coding Sequences) into a format similar to glimmer program output.
gbk2g2(gbkfile = "https://pbil.univ-lyon1.fr/datasets/seqinr/data/ct.gbk", g2.coord = "g2.coord")gbk2g2(gbkfile = "https://pbil.univ-lyon1.fr/datasets/seqinr/data/ct.gbk", g2.coord = "g2.coord")
gbkfile |
The name of the GenBank file |
g2.coord |
The name of the output file in glimmer-like format |
Partial CDS (either 5' or 3') and join in features are discarded.
The input file is returned invisibly.
J.R. Lobry
citation("seqinr")
oriloc which uses glimmer-like files,
gbk2g2.euk for eukaryotic sequences with introns.
## Not run: # need internet connection suppressWarnings(gbk2g2(g2.coord = "gbk2g2.test")) res <- read.table("gbk2g2.test") head(res) stopifnot(nrow(res) == 892) ## End(Not run)## Not run: # need internet connection suppressWarnings(gbk2g2(g2.coord = "gbk2g2.test")) res <- read.table("gbk2g2.test") head(res) stopifnot(nrow(res) == 892) ## End(Not run)
This function reads a file in GenBank format and converts the features corresponding to CDS (Coding Sequences) into a format similar to glimmer program output. This function is specifically made for eukaryotic sequences, i.e. with introns.
gbk2g2.euk(gbkfile = system.file("sequences/ame1.gbk", package ="seqinr"), g2.coord = "g2.coord")gbk2g2.euk(gbkfile = system.file("sequences/ame1.gbk", package ="seqinr"), g2.coord = "g2.coord")
gbkfile |
The name of the GenBank file |
g2.coord |
The name of the output file |
This function returns the coordinates of the exons annotated in the GenBank format file.
A data frame with three columns will be written to the g2.coord
file. The first column corresponds to the name of the gene, given in the
GenBank file through the /gene feature. The second and third
column contain the start and the stop position of the exon.
J.R. Lobry, A. Necşulea
citation("seqinr")
## Not run: gbk2g2.euk()## Not run: gbk2g2.euk()
This data set was used in Naya et al. (2002) to study the relationship between the genomic G+C content of bacteria and whether they are (stricly) aerobes or anaerobes.
gcO2 is a data frame.
Naya, H., Romero, H., Zavala, A., Alvarez, B. and Musto, H. (2002) Aerobiosis increases the Genomic Guanine Plus Cytosine Content (GC
Data imported into seqinr by J.R. Lobry on 09-OCT-2016. Original source location given in the article was http://oeg.fcien.edu.uy/GCprok/ but is no more active. Data were copied at http://pbil.univ-lyon1.fr/R/donnees/gcO2.txt (cf. section 2.1 in Lobry, J.R (2004) Life history traits and genome structure: aerobiosis and G+C content in bacteria. Lecture Notes in Computer Sciences, 3039:679-686). Import was from this last ressource. There are 130 aerobic genera in this data set while fig. 1 in Naya et al. (2002) gives 126. There is no way to track down the reason for this difference because the original data set was lost (Héctor Musto pers. comm.). The number of anaerobic genera (n = 69) is consistent between the present data set and fig. 1 in Naya et al. (2002).
citation("seqinr")
data(gcO2)data(gcO2)
This data set was used in Galtier and Lobry (1997) to study the relationship between the optimal growth temperature of bacteria and their G+C content at the genomic level and locally were selection is active to maintain secondary structures in the stems of RNAs.
gcT is a list containing the 9 following components:
is a data frame containing the optimal growth temperature and genomic G+C content for 772 bacterial species. Detailled explanations for this table and the following are available in the README component.
is a data frame containing the optimal growth temperature and genomic G+C content for 224 bacterial genus.
is a data frame with more information, see README.
is a data frame containing the optimal growth temperature and stems G+C content for 16S RNA from 165 bacterial genus.
is a data frame containing the optimal growth temperature and stems G+C content for tRNA from 51 bacterial genus.
is a data frame containing the optimal growth temperature and stems G+C content for 23S RNA from 38 bacterial genus.
is a data frame containing the optimal growth temperature and stems G+C content for 5S RNA from 71 bacterial genus.
is the original README file from ftp://biom3.univ-lyon1.fr/pub/datasets/JME97/ last updated 13-MAY-2002.
is the R script used to import data.
Galtier, N. & Lobry, J.R. (1997). Relationships between genomic G+C
content, RNA secondary structures, and optimal growth temperature
in prokaryotes. Journal of Molecular Evolution 44:632-636.
Data imported into seqinr with the R script given in the last component of the dataset by J.R. Lobry on 09-OCT-2016.
citation("seqinr")
data(gcT)data(gcT)
Connects to the embl database to read the last release note about the number of nucleotides in the DDBJ/EMBL/Genbank database content. A log-linear fit is represented by dia.bd.gowth() with an estimate of the doubling time in months.
get.db.growth( where = "ftp://ftp.ebi.ac.uk/pub/databases/embl/doc/relnotes.txt") dia.db.growth( get.db.growth.out = get.db.growth(), Moore = TRUE, ... )get.db.growth( where = "ftp://ftp.ebi.ac.uk/pub/databases/embl/doc/relnotes.txt") dia.db.growth( get.db.growth.out = get.db.growth(), Moore = TRUE, ... )
where |
the file containig the database growth table. |
get.db.growth.out |
the output from get.db.growth() |
Moore |
logical, if TRUE add lines corresponding to an exponential growth rate with a doubling time of 18 months, that is Moore's law. |
... |
further arguments to plot |
This is a screenshot from fig. 1 in Lobry (2004):
At that time the doubling time was 16.9 months. This is an update in 2016 from release 3.1-5 of the seqinr tutorial https://seqinr.r-forge.r-project.org/seqinr_3_1-5.pdf:
The doubling time was 18.8 monts in this update. The fit to Moore's law is still striking over such a long period.
A dataframe with the statistics from the embl site.
J.R. Lobry
https://www.ebi.ac.uk/ena/browser/
Lobry, J.R. (2004) Life History Traits and Genome Structure: Aerobiosis and G+C Content in Bacteria. Lectures Notes in Computer Sciences, 3039:679-686.
citation("seqinr")
## Not run: ### Need internet connection data <- get.db.growth() dia.db.growth(data) ## End(Not run)## Not run: ### Need internet connection data <- get.db.growth() dia.db.growth(data) ## End(Not run)
Annotations are taken from the Annot attribute for sequences
imported from a FASTA file and retrieved from an ACNUC server for
objects of the SeqAcnucWeb class.
getAnnot(object, ...) ## S3 method for class 'SeqAcnucWeb' getAnnot(object, ..., nbl = 100, socket = autosocket())getAnnot(object, ...) ## S3 method for class 'SeqAcnucWeb' getAnnot(object, ..., nbl = 100, socket = autosocket())
object |
an object of the class |
nbl |
the maximum number of line of annotation to read. Reading of lines stops when nbl lines have been transmitted or at the last annotation line of the sequence (SQ or ORIGIN line). |
socket |
an object of class |
... |
further arguments passed to or from other methods |
getAnnot returns a vector of string of characters containing the
annotations for the sequences.
D. Charif, J.R. Lobry, L. Palmeira
citation("seqinr")
query, SeqAcnucWeb, c2s, translate and prepgetannots to select the annotation lines.
# # List all available methods for getAnnot generic function: # methods(getAnnot) # # SeqAcnucWeb class example: # ## Not run: # Need internet connection choosebank("emblTP") fc<-query("fc", "sp=felis catus et t=cds et O=mitochondrion et Y>2001 et no k=partial") # get the first 5 lines annotating the first sequence: annots <- getAnnot(fc$req[[1]], nbl = 5) cat(annots, sep = "\n") # or use the list method to get them all at once: annots <- getAnnot(fc$req, nbl = 5) cat(annots, sep = "\n") closebank() ## End(Not run) # # SeqFastaAA class example: # aafile <- system.file("sequences/seqAA.fasta", package = "seqinr") sfaa <- read.fasta(aafile, seqtype = "AA") getAnnot(sfaa[[1]]) # # SeqFastadna class example: # dnafile <- system.file("sequences/malM.fasta", package = "seqinr") sfdna <- read.fasta(file = dnafile) getAnnot(sfdna[[1]]) # # Example with a FASTA file with multiple entries: # ff <- system.file("sequences/someORF.fsa", package = "seqinr") fs <- read.fasta(ff) getAnnot(fs) # the list method is used here to get them all at once # # Default getAnnot method example. An error is produced because # there are no annotations by default: # result <- try(getAnnot(letters)) stopifnot(!inherits("result", "try-error"))# # List all available methods for getAnnot generic function: # methods(getAnnot) # # SeqAcnucWeb class example: # ## Not run: # Need internet connection choosebank("emblTP") fc<-query("fc", "sp=felis catus et t=cds et O=mitochondrion et Y>2001 et no k=partial") # get the first 5 lines annotating the first sequence: annots <- getAnnot(fc$req[[1]], nbl = 5) cat(annots, sep = "\n") # or use the list method to get them all at once: annots <- getAnnot(fc$req, nbl = 5) cat(annots, sep = "\n") closebank() ## End(Not run) # # SeqFastaAA class example: # aafile <- system.file("sequences/seqAA.fasta", package = "seqinr") sfaa <- read.fasta(aafile, seqtype = "AA") getAnnot(sfaa[[1]]) # # SeqFastadna class example: # dnafile <- system.file("sequences/malM.fasta", package = "seqinr") sfdna <- read.fasta(file = dnafile) getAnnot(sfdna[[1]]) # # Example with a FASTA file with multiple entries: # ff <- system.file("sequences/someORF.fsa", package = "seqinr") fs <- read.fasta(ff) getAnnot(fs) # the list method is used here to get them all at once # # Default getAnnot method example. An error is produced because # there are no annotations by default: # result <- try(getAnnot(letters)) stopifnot(!inherits("result", "try-error"))
getFrag is used to extract the sequence fragment starting at the begin position
and ending at the end position.
getFrag(object, begin, end, ...) ## S3 method for class 'SeqAcnucWeb' getFrag(object, begin, end, ..., socket = autosocket(), name = getName(object)) ## S3 method for class 'SeqFastadna' getFrag(object, begin, end, ..., name = getName(object)) ## S3 method for class 'SeqFastaAA' getFrag(object, begin, end, ..., name = getName(object)) ## S3 method for class 'SeqFrag' getFrag(object, begin, end, ..., name = getName(object))getFrag(object, begin, end, ...) ## S3 method for class 'SeqAcnucWeb' getFrag(object, begin, end, ..., socket = autosocket(), name = getName(object)) ## S3 method for class 'SeqFastadna' getFrag(object, begin, end, ..., name = getName(object)) ## S3 method for class 'SeqFastaAA' getFrag(object, begin, end, ..., name = getName(object)) ## S3 method for class 'SeqFrag' getFrag(object, begin, end, ..., name = getName(object))
object |
an object of the class |
begin |
First position of the fragment to extract. This position is included. Numerotation starts at 1. |
end |
Last position of the fragment to extract. This position is included. |
socket |
an object of class |
name |
the sequence name |
... |
further arguments passed to or from other methods |
getFrag returns an object of class SeqFrag.
D. Charif, J.R. Lobry, L. Palmeira
citation("seqinr")
SeqAcnucWeb, SeqFastadna, SeqFastaAA, SeqFrag
# # List all available methods for getFrag generic function: # methods(getFrag) # # Example with a DNA sequence from a FASTA file: # dnafile <- system.file("sequences/malM.fasta", package = "seqinr") sfdna <- read.fasta(file = dnafile) myfrag <- getFrag(sfdna[[1]], begin = 1, end = 10) stopifnot(getSequence(myfrag, as.string = TRUE) == "atgaaaatga")# # List all available methods for getFrag generic function: # methods(getFrag) # # Example with a DNA sequence from a FASTA file: # dnafile <- system.file("sequences/malM.fasta", package = "seqinr") sfdna <- read.fasta(file = dnafile) myfrag <- getFrag(sfdna[[1]], begin = 1, end = 10) stopifnot(getSequence(myfrag, as.string = TRUE) == "atgaaaatga")
Get keywords from an ACNUC server.
getKeyword(object, ...) ## S3 method for class 'SeqAcnucWeb' getKeyword(object, ..., socket = autosocket())getKeyword(object, ...) ## S3 method for class 'SeqAcnucWeb' getKeyword(object, ..., socket = autosocket())
object |
an object of the class |
socket |
an object of class |
... |
further arguments passed to or from other methods |
getKeyword returns a vector of strings containing the keyword(s)
associated to a sequence.
D. Charif, J.R. Lobry, L. Palmeira
citation("seqinr")
# # List all available methods for getKeyword generic function: # methods(getKeyword) # # Example of keyword extraction from an ACNUC server: # ## Not run: # Need internet connection choosebank("emblTP") fc<-query("fc", "sp=felis catus et t=cds et o=mitochondrion") getKeyword(fc$req[[1]]) # Should be: # [1] "DIVISION ORG" "RELEASE 62" "CYTOCHROME B" "SOURCE" "CDS" closebank() ## End(Not run)# # List all available methods for getKeyword generic function: # methods(getKeyword) # # Example of keyword extraction from an ACNUC server: # ## Not run: # Need internet connection choosebank("emblTP") fc<-query("fc", "sp=felis catus et t=cds et o=mitochondrion") getKeyword(fc$req[[1]]) # Should be: # [1] "DIVISION ORG" "RELEASE 62" "CYTOCHROME B" "SOURCE" "CDS" closebank() ## End(Not run)
getLength returns the total number of bases or amino-acids in a sequence.
getLength(object, ...)getLength(object, ...)
object |
an object of the class |
... |
further arguments passed to or from other methods |
getLength returns a numeric vector giving the length of the
sequences.
D. Charif, J.R. Lobry, L. Palmeira
citation("seqinr")
SeqAcnucWeb, SeqFastadna,
SeqFastaAA, SeqFrag
# # List all available methods for getLength generic function: # methods(getLength) # # Example with seven DNA sequences from a FASTA file: # ff <- system.file("sequences/someORF.fsa", package = "seqinr") fs <- read.fasta(file = ff) stopifnot(all(getLength(fs) == c(5573, 5825, 2987, 3929, 2648, 2597, 2780))) # # Example with 49 sequences from an ACNUC server: # ## Not run: # Need internet connection choosebank("emblTP") fc <- query("fc", "sp=felis catus et t=cds et o=mitochondrion") getLength(fc) closebank() ## End(Not run)# # List all available methods for getLength generic function: # methods(getLength) # # Example with seven DNA sequences from a FASTA file: # ff <- system.file("sequences/someORF.fsa", package = "seqinr") fs <- read.fasta(file = ff) stopifnot(all(getLength(fs) == c(5573, 5825, 2987, 3929, 2648, 2597, 2780))) # # Example with 49 sequences from an ACNUC server: # ## Not run: # Need internet connection choosebank("emblTP") fc <- query("fc", "sp=felis catus et t=cds et o=mitochondrion") getLength(fc) closebank() ## End(Not run)
This is a low level function to get the rank of a list on server from its name.
getlistrank(listname, socket = autosocket(), verbose = FALSE) glr(listname, socket = autosocket(), verbose = FALSE)getlistrank(listname, socket = autosocket(), verbose = FALSE) glr(listname, socket = autosocket(), verbose = FALSE)
listname |
the name of list on server |
socket |
an object of class |
verbose |
if |
This low level function is usually not used directly by the user.
The rank of list named listname on server, or 0 if no list with this name exists.
J.R. Lobry
citation("seqinr")
## Not run: # Need internet connection choosebank("emblTP") MyListName <- query("MyListName", "sp=Borrelia burgdorferi", virtual = TRUE) (result <- getlistrank("MyListName")) stopifnot(result == 2) closebank() ## End(Not run)## Not run: # Need internet connection choosebank("emblTP") MyListName <- query("MyListName", "sp=Borrelia burgdorferi", virtual = TRUE) (result <- getlistrank("MyListName")) stopifnot(result == 2) closebank() ## End(Not run)
Reply gives the type of list, its name, the number of elements it contains, and, for sequence lists, says whether the list contains only parent seqs (locus=T).
getliststate(lrank, socket = autosocket()) gls(lrank, socket = autosocket()) gln(lrank, ...)getliststate(lrank, socket = autosocket()) gls(lrank, socket = autosocket()) gln(lrank, ...)
lrank |
the name of the ACNUC list to modify |
socket |
an object of class |
... |
arguments passed to getliststate |
NA in case of problem and an warning is issued. When there is no problem a list with the following 4 components:
type |
string. Type of ACNUC list (SQ, KW, SP) |
name |
string. ACNUC list name |
count |
numeric. Number of elements in ACNUC list |
locus |
logical. For ACNUC sequence lists TRUE means that the list contains only parent sequences. NA otherwise. |
gln is a shortcut for getliststate(lrank, ...)$name
J.R. Lobry
https://doua.prabi.fr/databases/acnuc.html
citation("seqinr")
choosebank, query, alr,
glr
## Not run: ### Need internet connection choosebank("emblTP") mylist <- query("mylist", "sp=felis catus et t=cds", virtual=TRUE) getliststate(glr("mylist")) # SQ, MYLIST, 603, FALSE gln(glr("mylist")) # MYLIST (upper case letters on server) closebank() ## End(Not run)## Not run: ### Need internet connection choosebank("emblTP") mylist <- query("mylist", "sp=felis catus et t=cds", virtual=TRUE) getliststate(glr("mylist")) # SQ, MYLIST, 603, FALSE gln(glr("mylist")) # MYLIST (upper case letters on server) closebank() ## End(Not run)
This function works only with subsequences from an ACNUC server.
getLocation(object, ...) ## S3 method for class 'SeqAcnucWeb' getLocation(object, ..., socket = autosocket())getLocation(object, ...) ## S3 method for class 'SeqAcnucWeb' getLocation(object, ..., socket = autosocket())
object |
an object of the class |
socket |
an object of class |
... |
further arguments passed to or from other methods |
A list giving the positions of the sequence on the parent sequence. If the sequence is a subsequence (e.g. coding sequence), the function returns the position of each exon on the parent sequence. NA is returned for parent sequences and a warning is isued.
D. Charif, J.R. Lobry, L. Palmeira
citation("seqinr")
# # List all available methods for getLocation generic function: # methods(getLocation) # # Example with a subsequence from an ACNUC server: # ## Not run: # Need internet connection choosebank("emblTP") fc <- query("fc", "sp=felis catus et t=cds et o=mitochondrion") getLocation(fc$req[[5]]) closebank() ## End(Not run)# # List all available methods for getLocation generic function: # methods(getLocation) # # Example with a subsequence from an ACNUC server: # ## Not run: # Need internet connection choosebank("emblTP") fc <- query("fc", "sp=felis catus et t=cds et o=mitochondrion") getLocation(fc$req[[5]]) closebank() ## End(Not run)
GetName returns the sequence names.
getName(object, ...)getName(object, ...)
object |
an object of the class |
... |
further arguments passed to or from other methods |
an object of class character containing the names of the sequences
D. Charif, J.R. Lobry, L. Palmeira
citation("seqinr")
SeqAcnucWeb, SeqFastadna,
SeqFastaAA, SeqFrag
# # List all available methods for getName generic function: # methods(getName) # # Example with seven DNA sequences from a FASTA file: # ff <- system.file("sequences/someORF.fsa", package = "seqinr") fs <- read.fasta(file = ff) stopifnot(all(getName(fs) == c("YAL001C", "YAL002W", "YAL003W", "YAL005C", "YAL007C", "YAL008W", "YAL009W"))) # # Example with 49 sequences from an ACNUC server: # ## Not run: # Need internet connection choosebank("emblTP") fc <- query("fc", "sp=felis catus et t=cds et o=mitochondrion") getName(fc) closebank() ## End(Not run)# # List all available methods for getName generic function: # methods(getName) # # Example with seven DNA sequences from a FASTA file: # ff <- system.file("sequences/someORF.fsa", package = "seqinr") fs <- read.fasta(file = ff) stopifnot(all(getName(fs) == c("YAL001C", "YAL002W", "YAL003W", "YAL005C", "YAL007C", "YAL008W", "YAL009W"))) # # Example with 49 sequences from an ACNUC server: # ## Not run: # Need internet connection choosebank("emblTP") fc <- query("fc", "sp=felis catus et t=cds et o=mitochondrion") getName(fc) closebank() ## End(Not run)
getSequence returns the sequence either as vector of single chararacters or as a single string of multiple characters.
getSequence(object, as.string = FALSE, ...) ## S3 method for class 'SeqAcnucWeb' getSequence(object, as.string = FALSE, ..., socket = autosocket())getSequence(object, as.string = FALSE, ...) ## S3 method for class 'SeqAcnucWeb' getSequence(object, as.string = FALSE, ..., socket = autosocket())
object |
an object of the class |
as.string |
if TRUE sequences are returned as strings of multiple characters instead of a vector of single characters |
socket |
an object of class |
... |
further arguments passed to or from other methods |
For a single sequence an object of class character containing the characters
of the sequence, either of length 1 when as.string is TRUE, or of the length
of the sequence when as.string is FALSE. For many sequences, a list of these.
D. Charif, J.R. Lobry, L. Palmeira
citation("seqinr")
SeqAcnucWeb, SeqFastadna,
SeqFastaAA, SeqFrag
# # List all available methods for getSequence generic function: # methods(getSequence) # # SeqAcnucWeb class example: # ## Not run: # Need internet connection choosebank("emblTP") fc <- query("fc", "sp=felis catus et t=cds et o=mitochondrion") getSequence(fc$req[[1]]) getSequence(fc$req[[1]], as.string = TRUE) closebank() ## End(Not run) # # SeqFastaAA class example: # aafile <- system.file("sequences/seqAA.fasta", package = "seqinr") sfaa <- read.fasta(aafile, seqtype = "AA") getSequence(sfaa[[1]]) getSequence(sfaa[[1]], as.string = TRUE) # # SeqFastadna class example: # dnafile <- system.file("sequences/someORF.fsa", package = "seqinr") sfdna <- read.fasta(file = dnafile) getSequence(sfdna[[1]]) getSequence(sfdna[[1]], as.string = TRUE) # # SeqFrag class example: # sfrag <- getFrag(object = sfdna[[1]], begin = 1, end = 10) getSequence(sfrag) getSequence(sfrag, as.string = TRUE)# # List all available methods for getSequence generic function: # methods(getSequence) # # SeqAcnucWeb class example: # ## Not run: # Need internet connection choosebank("emblTP") fc <- query("fc", "sp=felis catus et t=cds et o=mitochondrion") getSequence(fc$req[[1]]) getSequence(fc$req[[1]], as.string = TRUE) closebank() ## End(Not run) # # SeqFastaAA class example: # aafile <- system.file("sequences/seqAA.fasta", package = "seqinr") sfaa <- read.fasta(aafile, seqtype = "AA") getSequence(sfaa[[1]]) getSequence(sfaa[[1]], as.string = TRUE) # # SeqFastadna class example: # dnafile <- system.file("sequences/someORF.fsa", package = "seqinr") sfdna <- read.fasta(file = dnafile) getSequence(sfdna[[1]]) getSequence(sfdna[[1]], as.string = TRUE) # # SeqFrag class example: # sfrag <- getFrag(object = sfdna[[1]], begin = 1, end = 10) getSequence(sfrag) getSequence(sfrag, as.string = TRUE)
This function translates nucleic acid sequences into the corresponding peptide sequence. It can translate in any of the 3 forward or three reverse sense frames. In the case of reverse sense, the reverse-complement of the sequence is taken. It can translate using the standard (universal) genetic code and also with non-standard codes. Ambiguous bases can also be handled.
getTrans(object, sens = "F", NAstring = "X", ambiguous = FALSE, force.first.aa.to.Met = FALSE, ...) ## S3 method for class 'SeqAcnucWeb' getTrans(object, sens = "F", NAstring = "X", ambiguous = FALSE, force.first.aa.to.Met = FALSE, ..., frame = "auto", numcode = "auto") ## S3 method for class 'SeqFastadna' getTrans(object, sens = "F", NAstring = "X", ambiguous = FALSE, force.first.aa.to.Met = FALSE, ..., frame = 0, numcode = 1) ## S3 method for class 'SeqFrag' getTrans(object, sens = "F", NAstring = "X", ambiguous = FALSE, force.first.aa.to.Met = FALSE, ..., frame = 0, numcode = 1)getTrans(object, sens = "F", NAstring = "X", ambiguous = FALSE, force.first.aa.to.Met = FALSE, ...) ## S3 method for class 'SeqAcnucWeb' getTrans(object, sens = "F", NAstring = "X", ambiguous = FALSE, force.first.aa.to.Met = FALSE, ..., frame = "auto", numcode = "auto") ## S3 method for class 'SeqFastadna' getTrans(object, sens = "F", NAstring = "X", ambiguous = FALSE, force.first.aa.to.Met = FALSE, ..., frame = 0, numcode = 1) ## S3 method for class 'SeqFrag' getTrans(object, sens = "F", NAstring = "X", ambiguous = FALSE, force.first.aa.to.Met = FALSE, ..., frame = 0, numcode = 1)
object |
an object of the class |
numcode |
The ncbi genetic code number for translation. By default the standard genetic code is used, and for sequences coming from an ACNUC server the relevant genetic code is used by default. |
NAstring |
How to translate amino-acids when there are ambiguous bases in codons. |
ambiguous |
If TRUE, ambiguous bases are taken into account so that for instance GGN is translated to Gly in the standard genetic code. |
force.first.aa.to.Met |
If TRUE, the first codon in the sequence will be translated to Methionine regardless of the codon in order to treat rare start codons like TTG. |
frame |
Frame(s) (0,1,2) to translate. By default the frame |
sens |
Direction for translation: |
... |
further arguments passed to or from other methods |
The following genetic codes are described here. The number preceding each code
corresponds to numcode.
standard
vertebrate.mitochondrial
yeast.mitochondrial
protozoan.mitochondrial+mycoplasma
invertebrate.mitochondrial
ciliate+dasycladaceal
echinoderm+flatworm.mitochondrial
euplotid
bacterial+plantplastid
alternativeyeast
ascidian.mitochondrial
alternativeflatworm.mitochondrial
blepharism
chlorophycean.mitochondrial
trematode.mitochondrial
scenedesmus.mitochondrial
hraustochytrium.mitochondria
For a single sequence an object of class character containing the characters
of the sequence, either of length 1 when as.string is TRUE, or of the length
of the sequence when as.string is FALSE. For many sequences, a list of these.
D. Charif, J.R. Lobry, L. Palmeira
citation("seqinr")
SeqAcnucWeb, SeqFastadna, SeqFrag
The genetic codes are given in the object SEQINR.UTIL, a more
human readable form is given by the function tablecode.
Use aaa to get the three-letter code for amino-acids.
# # List all available methods for getTrans generic function: # methods(getTrans) # # Toy CDS example invented by Leonor Palmeira: # toycds <- s2c("tctgagcaaataaatcgg") getTrans(toycds) # should be c("S", "E", "Q", "I", "N", "R") getTrans(toycds, force.first.aa.to.Met = TRUE) # should be c("M", "E", "Q", "I", "N", "R") # # Toy CDS example with ambiguous bases: # toycds2 <- s2c("tcngarcarathaaycgn") getTrans(toycds2) # should be c("X", "X", "X", "X", "X", "X") getTrans(toycds2, ambiguous = TRUE) # should be c("S", "E", "Q", "I", "N", "R") getTrans(toycds2, ambiguous = TRUE, numcode = 2) # should be c("S", "E", "Q", "X", "N", "R") # # Real CDS example: # realcds <- read.fasta(file = system.file("sequences/malM.fasta", package ="seqinr"))[[1]] getTrans(realcds) # Biologically correct, only one stop codon at the end getTrans(realcds, frame = 3, sens = "R", numcode = 6) # Biologically meaningless, note the in-frame stop codons # Read from an alignment as suggested by Dr. H. Suzuki fasta.res <- read.alignment(file = system.file("sequences/Anouk.fasta", package = "seqinr"), format = "fasta") AA1 <- seqinr::getTrans(s2c(fasta.res$seq[[1]])) AA2 <- seqinr::translate(s2c(fasta.res$seq[[1]])) identical(AA1, AA2) AA1 <- lapply(fasta.res$seq, function(x) seqinr::getTrans(s2c(x))) AA2 <- lapply(fasta.res$seq, function(x) seqinr::translate(s2c(x))) identical(AA1, AA2) # # Complex transsplicing operations, the correct frame and the correct # genetic code are automatically used for translation into protein for # sequences coming from an ACNUC server: # ## Not run: # Need internet connection. # Translation of the following EMBL entry: # # FT CDS join(complement(153944..154157),complement(153727..153866), # FT complement(152185..153037),138523..138735,138795..138955) # FT /codon_start=1 choosebank("emblTP") trans <- query("trans", "N=AE003734.PE35") getTrans(trans$req[[1]]) ## End(Not run)# # List all available methods for getTrans generic function: # methods(getTrans) # # Toy CDS example invented by Leonor Palmeira: # toycds <- s2c("tctgagcaaataaatcgg") getTrans(toycds) # should be c("S", "E", "Q", "I", "N", "R") getTrans(toycds, force.first.aa.to.Met = TRUE) # should be c("M", "E", "Q", "I", "N", "R") # # Toy CDS example with ambiguous bases: # toycds2 <- s2c("tcngarcarathaaycgn") getTrans(toycds2) # should be c("X", "X", "X", "X", "X", "X") getTrans(toycds2, ambiguous = TRUE) # should be c("S", "E", "Q", "I", "N", "R") getTrans(toycds2, ambiguous = TRUE, numcode = 2) # should be c("S", "E", "Q", "X", "N", "R") # # Real CDS example: # realcds <- read.fasta(file = system.file("sequences/malM.fasta", package ="seqinr"))[[1]] getTrans(realcds) # Biologically correct, only one stop codon at the end getTrans(realcds, frame = 3, sens = "R", numcode = 6) # Biologically meaningless, note the in-frame stop codons # Read from an alignment as suggested by Dr. H. Suzuki fasta.res <- read.alignment(file = system.file("sequences/Anouk.fasta", package = "seqinr"), format = "fasta") AA1 <- seqinr::getTrans(s2c(fasta.res$seq[[1]])) AA2 <- seqinr::translate(s2c(fasta.res$seq[[1]])) identical(AA1, AA2) AA1 <- lapply(fasta.res$seq, function(x) seqinr::getTrans(s2c(x))) AA2 <- lapply(fasta.res$seq, function(x) seqinr::translate(s2c(x))) identical(AA1, AA2) # # Complex transsplicing operations, the correct frame and the correct # genetic code are automatically used for translation into protein for # sequences coming from an ACNUC server: # ## Not run: # Need internet connection. # Translation of the following EMBL entry: # # FT CDS join(complement(153944..154157),complement(153727..153866), # FT complement(152185..153037),138523..138735,138795..138955) # FT /codon_start=1 choosebank("emblTP") trans <- query("trans", "N=AE003734.PE35") getTrans(trans$req[[1]]) ## End(Not run)
This function returns all subsequence types (e.g. CDS, TRNA) present in an opened ACNUC database, using default database if no socket is provided.
getType(socket = autosocket())getType(socket = autosocket())
socket |
an object of class |
a list containing a short description for each subsequence type.
D. Charif, J.R. Lobry
citation("seqinr")
## Not run: # Need internet connection choosebank("emblTP") getType() ## End(Not run)## Not run: # Need internet connection choosebank("emblTP") getType() ## End(Not run)
Get length characters from sequence identified by name or by number
starting from position start (counted from 1).
gfrag(what, start, length, idby = c("name", "number"), socket = autosocket())gfrag(what, start, length, idby = c("name", "number"), socket = autosocket())
what |
A sequence name or number |
start |
Start position from 1 |
length |
Number of requested characters (answer may be shorter) |
idby |
Is the sequence identified by name or number? Default to name |
socket |
an object of class |
A string of characters with at most length characters (may be
shorter than asked for). NA is returned and a warning is issued in
case of problem (non existent sequence for instance).
J.R. Lobry
https://doua.prabi.fr/databases/acnuc.html
citation("seqinr")
## Not run: # Need internet connection choosebank("emblTP") gfrag("LMFLCHR36", start = 1, length = 3529852) -> myseq stopifnot(nchar(myseq) == 3529852) closebank() ## End(Not run)## Not run: # Need internet connection choosebank("emblTP") gfrag("LMFLCHR36", start = 1, length = 3529852) -> myseq stopifnot(nchar(myseq) == 3529852) closebank() ## End(Not run)
Reads one item of information in specified help file from an ACNUC server. The are differences between ACNUC clients so that this help could be confusing. However, the query language is common to all clients so that the most recent documentation is most likely here.
ghelp(item = c("GENERAL", "SELECT", "SPECIES", "KEYWORD"), file = c("HELP", "HELP_WIN"), socket = autosocket(), catresult = TRUE)ghelp(item = c("GENERAL", "SELECT", "SPECIES", "KEYWORD"), file = c("HELP", "HELP_WIN"), socket = autosocket(), catresult = TRUE)
item |
the name of the desired help item |
file |
the name of the help file on server side. |
socket |
an object of class |
catresult |
logical. If TRUE output is redirected to the console. |
A vector of string which is returned invisibly and "cated" to the console by default.
J.R. Lobry
https://doua.prabi.fr/databases/acnuc.html
citation("seqinr")
## Not run: ### Need internet connection choosebank("emblTP") ghelp() ghelp("SELECT") # To get info about current database: ghelp("CONT") ## End(Not run)## Not run: ### Need internet connection choosebank("emblTP") ghelp() ghelp("SELECT") # To get info about current database: ghelp("CONT") ## End(Not run)
GS500LIZ is an internal size standard often used in capillary electrophoresis. It contains 16 fragments ranging in size from 35 to 500 bp. Note that they are not all used for calibration : fragments at 250 and 340 bp may migrate anomalously (most likey because of secondary structure formation).
data(gs500liz)data(gs500liz)
A list with 3 components.
a vector of 16 values for the fragment sizes in bp.
a vector of 16 logicals to remove fragments whose migration may be anomalous (250 and 340 bp).
a vector of 16 logicals to remove extreme fragments (35, 50, 490, 500 bp) so that the resulting fragments are in the 75-450 bp range.
data(gs500liz) op <- par(no.readonly = TRUE) par(lend = "butt", mar = c(5,0,4,0)+0.1) x <- gs500liz$liz n <- length(x) y <- rep(1, n) plot(x, y, type = "h", yaxt = "n", xlab = "Fragment size [bp]", main = "GS500LIZ size standard", lwd = 2) x1 <- x[!gs500liz$mask1] segments(x1, 0, x1, 1, col = "red", lwd = 2) x2 <- x[!gs500liz$mask2] segments(x2, 0, x2, 1, col = "blue", lwd = 2) col <- rep("black", n) col[!gs500liz$mask1] <- "red" col[!gs500liz$mask2] <- "blue" text(x,1.05,paste(x, "bp"), srt = 90, col = col) legend("top", inset = 0.1, legend = c("regular", "imprecise (mask1)", "extreme (mask2)"), lwd = 2, col = c("black","red","blue")) par(op)data(gs500liz) op <- par(no.readonly = TRUE) par(lend = "butt", mar = c(5,0,4,0)+0.1) x <- gs500liz$liz n <- length(x) y <- rep(1, n) plot(x, y, type = "h", yaxt = "n", xlab = "Fragment size [bp]", main = "GS500LIZ size standard", lwd = 2) x1 <- x[!gs500liz$mask1] segments(x1, 0, x1, 1, col = "red", lwd = 2) x2 <- x[!gs500liz$mask2] segments(x2, 0, x2, 1, col = "blue", lwd = 2) col <- rep("black", n) col[!gs500liz$mask1] <- "red" col[!gs500liz$mask2] <- "blue" text(x,1.05,paste(x, "bp"), srt = 90, col = col) legend("top", inset = 0.1, legend = c("regular", "imprecise (mask1)", "extreme (mask2)"), lwd = 2, col = c("black","red","blue")) par(op)
Names of the alleles in the Applied Biosystem identifiler allelic ladder.
data(identifiler)data(identifiler)
A list with 4 components for the four fluorochromes.
a list of 4 loci
a list of 5 loci
a list of 4 loci
a list of 3 loci
data(identifiler) op <- par(no.readonly = TRUE) par(mar = c(3,8,4,2)+0.1) allcount <- unlist(lapply(identifiler, function(x) lapply(x, length))) barplot(allcount[order(allcount)], horiz = TRUE, las = 1, main = "Allele count per locus", col = "lightblue") par(op)data(identifiler) op <- par(no.readonly = TRUE) par(mar = c(3,8,4,2)+0.1) allcount <- unlist(lapply(identifiler, function(x) lapply(x, length))) barplot(allcount[order(allcount)], horiz = TRUE, las = 1, main = "Allele count per locus", col = "lightblue") par(op)
Gives the ACNUC number of a sequence in the number element of the returned list.
More informations are returned for subsequences corresponding to coding sequences.
isenum(what, idby = c("name", "access"), socket = autosocket()) isn(what, ...) getNumber.socket(socket, name) getAttributsocket(socket, name)isenum(what, idby = c("name", "access"), socket = autosocket()) isn(what, ...) getNumber.socket(socket, name) getAttributsocket(socket, name)
what |
a sequence name or a sequence accession number |
idby |
is the sequence identified by name or by accession number? Default to name |
socket |
an object of class |
... |
arguments passed to |
name |
a sequence name. |
A list whith the following 6 components:
number |
numeric. The ACNUC number of the sequence. |
length |
numeric. The length of the sequence. |
frame |
numeric. The reading frame (0, 1, or 2) of the sequence for CDS. |
gencode |
numeric. ACNUC's genetic code (0 means universal) of the sequence for CDS. |
ncbigc |
numeric. NCBI's genetic code (0 means universal) of the sequence for CDS. |
otheraccessmatches |
logical. If TRUE it means that several sequences are attached
to the given accession nunmber, and that only the ACNUC number of the first attached
sequence is returned in the |
isn(what, ...) is a shortcut for isenum(what, ...)$number.
As from seqinR 1.1-3 getNumber.socket and
getAttributsocket are deprecated (a warning is issued).
J.R. Lobry
https://doua.prabi.fr/databases/acnuc.html
citation("seqinr")
## Not run: ### Need internet connection choosebank("emblTP") isenum("LMFLCHR36") isn("LMFLCHR36") stopifnot(isn("LMFLCHR36") == 13682678) # Example with CDS: isenum("AB004237") ## End(Not run)## Not run: ### Need internet connection choosebank("emblTP") isenum("LMFLCHR36") isn("LMFLCHR36") stopifnot(isn("LMFLCHR36") == 13682678) # Example with CDS: isenum("AB004237") ## End(Not run)
This is an example of raw data for a human STR genetic profile at 16 loci (viz. D8S1179, D21S11, D7S820, CSF1PO, D3S1358, TH01, D13S317, D16S539, D2S1338, D19S433, vWA, TPOX, D18S51, Amelogenin, D5S818, FGA) which are commonly used in forensic sciences for individual identifications.
data(JLO)data(JLO)
A list with 3 components.
a list corresponding to the header in the ABIF file
a data.frame corresponding to the Directory in the ABIF file
a list with all raw data in the ABIF file.
This dataset is the expected result when reading the file
2_FAC321_0000205983_B02_004.fsa with the
function read.abif. This dataset is used for
the quality check of this function.
J.R. Lobry
The DNA source is from the author so that there are no privacy concern. Data were kindly provided by the INPS (Institut National de Police Scientifique) which is the national forensic sciences institute in France. Experiments were done at the LPS (Laboratoire de Police Scientifique de Lyon) in 2008.
citation("seqinr")
Anonymous (2006) Applied Biosystem Genetic Analysis Data File Format. Available at https://www.thermofisher.com/de/de/home/brands/applied-biosystems.html. Last visited on 03-NOV-2008.
function read.abif to import files in ABIF format,
data gs500liz for internal size standards,
data ECH for the corresponding allelic ladder,
data identifiler for allele names in the allelic ladder.
data(JLO)data(JLO)
Ks and Ka are, respectively, the number of substitutions per synonymous site and per non-synonymous site between two protein-coding genes. They are also denoted as ds and dn in the literature. The ratio of nonsynonymous (Ka) to synonymous (Ks) nucleotide substitution rates is an indicator of selective pressures on genes. A ratio significantly greater than 1 indicates positive selective pressure. A ratio around 1 indicates either neutral evolution at the protein level or an averaging of sites under positive and negative selective pressures. A ratio less than 1 indicates pressures to conserve protein sequence (i.e. purifying selection). This function estimates the Ka and Ks values for a set of aligned sequences using the method published by Li (1993) and gives the associated variance matrix.
kaks(x, verbose = FALSE, debug = FALSE, forceUpperCase = TRUE, rmgap = TRUE)kaks(x, verbose = FALSE, debug = FALSE, forceUpperCase = TRUE, rmgap = TRUE)
x |
An object of class |
verbose |
If TRUE add to the results the value of L0, L2, L4 (respectively the frequency of non-synonymous sites, of 2-fold synonymous sites, of 4-fold synonymous sites), A0, A2, A4 (respectively the number of transitional changes at non-synonymous, 2-fold, and 4-fold synonymous sites ) and B0, B2, B4 (respectively the number of transversional changes at non-synonymous, 2-fold, and 4-fold synonymous sites). |
debug |
If TRUE turns debug mode on. |
forceUpperCase |
If TRUE, the default value, all character in sequences are forced to the upper case if at least one 'a', 'c', 'g', or 't' is found in the sequences. Turning it to FALSE if the sequences are already in upper case will save time. |
rmgap |
If TRUE all positions with at least one gap are removed. If FALSE only positions with nothing else than gaps are removed. |
ks |
matrix of Ks values |
ka |
matrix of Ka values |
vks |
variance matrix of Ks |
vka |
variance matrix of Ka |
Computing Ka and Ks makes sense for coding sequences that have been aligned at the amino-acid level before retro-translating the alignement at the nucleic acid level to ensure that sequences are compared on a codon-by-codon basis. Function reverse.align may help for this.
As from seqinR 2.0-3, when there is at least one non ACGT base in a codon, this codon is considered as a gap-codon (---). This makes the computation more robust with respect to alignments with out-of-frame gaps, see example section.
Gap-codons (---) are not used for computations.
When the alignment does not contain enough information (i.e. close to saturation), the Ka and Ks values are forced to 10 (more exactly to 9.999999).
Negative values indicate that Ka and Ks can not be computed.
According to Li (1993) and Pamilo and Bianchi (1993), the rate of synonymous substitutions Ks is computed as: Ks = (L2.A2 + L4.A4) / (L2 + L4) + B4
and the rate of non-synonymous substitutions Ka is computed as: Ka = A0 + (L0.B0 + L2.B2) / (L0 + L2)
D. Charif, J.R. Lobry
Li, W.-H., Wu, C.-I., Luo, C.-C. (1985) A new method for estimating synonymous and nonsynonymous rates of nucleotide substitution considering the relative likelihood of nucleotide and codon changes. Mol. Biol. Evol, 2:150-174
Li, W.-H. (1993) Unbiased estimation of the rates of synonymous and nonsynonymous substitution. J. Mol. Evol., 36:96-99.
Pamilo, P., Bianchi, N.O. (1993) Evolution of the Zfx and Zfy genes: Rates and interdependence between genes. Mol. Biol. Evol, 10:271-281
Hurst, L.D. (2002) The Ka/Ks ratio: diagnosing the form of sequence evolution.
Trends Genet., 18:486-486.
The C programm implementing this method was provided by Manolo Gouy. More info is
needed here to trace back the original C source so as to credit correct source.
The original FORTRAN-77 code by Chung-I Wu modified by Ken Wolfe is available
here: http://wolfe.ucd.ie/lab/pub/li93/ (last visited 2023-12-08).
For a more recent discussion about the estimation of Ka and Ks see:
Tzeng, Y.H., Pan, R., Li, W.-H. (2004) Comparison of three methods for estimating
rates of synonymous and nonsynonymous nucleotide substitutions.
Mol. Biol. Evol, 21:2290-2298.
The method implemented here is noted LWL85 in the above paper.
The cite this package in a publication, as any R package, try something as citation("seqinr")
at your R prompt.
read.alignment to import alignments from files, reverse.align to align CDS at the aa level,
kaksTorture for test on one-codon CDS.
# # Simple Toy example: # s <- read.alignment(file = system.file("sequences/test.phylip", package = "seqinr"), format = "phylip") kaks(s) # # Check numeric results on an simple test example: # data(AnoukResult) Anouk <- read.alignment(file = system.file("sequences/Anouk.fasta", package = "seqinr"), format = "fasta") if( ! all.equal(kaks(Anouk), AnoukResult) ) { warning("Poor numeric results with respect to AnoukResult standard") } else { print("Results are consistent with AnoukResult standard") } # # As from seqinR 2.0-3 the following alignment with out-of-frame gaps # should return a zero Ka value. # # >Reference # ATGTGGTCGAGATATCGAAAGCTAGGGATATCGATTATATATAGCAAGATCGATAGAGGA # TCGATGATCGATCGGGATCGACAGCTG # >With out-of-frame gaps # AT-TGGTCCAGGTATCGTAAGCTAGGGATATCGATTATATATAGCAAGATCGATAGGGGA # TCGATGATCGATCGGGA--GACAGCTG # # This test example provided by Darren Obbard is now used as a routine check: # Darren <- read.alignment(file = system.file("sequences/DarrenObbard.fasta", package = "seqinr"), format = "fasta") stopifnot( all.equal(kaks(Darren)$ka[1], 0) ) # # As from seqinR 3.4-0, non-finite values should never be returned for # Ka and Ks even for small sequences. The following test checks that this # is true for an alignement of the 64 codons, so that we compute Ka and # Ks for all possible pairs of codons. # wrd <- as.alignment(nb = 64, nam = words(), seq = words()) res <- kaks(wrd) if(any(!is.finite(res$ka))) stop("Non finite value returned for Ka") if(any(!is.finite(res$ks))) stop("Non finite value returned for Ks")# # Simple Toy example: # s <- read.alignment(file = system.file("sequences/test.phylip", package = "seqinr"), format = "phylip") kaks(s) # # Check numeric results on an simple test example: # data(AnoukResult) Anouk <- read.alignment(file = system.file("sequences/Anouk.fasta", package = "seqinr"), format = "fasta") if( ! all.equal(kaks(Anouk), AnoukResult) ) { warning("Poor numeric results with respect to AnoukResult standard") } else { print("Results are consistent with AnoukResult standard") } # # As from seqinR 2.0-3 the following alignment with out-of-frame gaps # should return a zero Ka value. # # >Reference # ATGTGGTCGAGATATCGAAAGCTAGGGATATCGATTATATATAGCAAGATCGATAGAGGA # TCGATGATCGATCGGGATCGACAGCTG # >With out-of-frame gaps # AT-TGGTCCAGGTATCGTAAGCTAGGGATATCGATTATATATAGCAAGATCGATAGGGGA # TCGATGATCGATCGGGA--GACAGCTG # # This test example provided by Darren Obbard is now used as a routine check: # Darren <- read.alignment(file = system.file("sequences/DarrenObbard.fasta", package = "seqinr"), format = "fasta") stopifnot( all.equal(kaks(Darren)$ka[1], 0) ) # # As from seqinR 3.4-0, non-finite values should never be returned for # Ka and Ks even for small sequences. The following test checks that this # is true for an alignement of the 64 codons, so that we compute Ka and # Ks for all possible pairs of codons. # wrd <- as.alignment(nb = 64, nam = words(), seq = words()) res <- kaks(wrd) if(any(!is.finite(res$ka))) stop("Non finite value returned for Ka") if(any(!is.finite(res$ks))) stop("Non finite value returned for Ks")
This data set is what should be obtained when runing kaks()
on the test file kaks-torture.fasta in the sequences directory of the
seqinR package.
data(kaksTorture)data(kaksTorture)
A list with 4 components of class dist.
Ka
Ks
variance for Ka
variance for Ks
See comments in kaks-torture.fasta for R code used to produce it.
citation("seqinr")
data(kaksTorture) kaks.torture <- read.alignment(file = system.file("sequences/kaks-torture.fasta", package = "seqinr"), format = "fasta") # # Failed on windows : # # stopifnot(identical(kaksTorture, kaks(kaks.torture))) # stopifnot(identical(kaksTorture, kaks(kaks.torture, rmgap = FALSE)))data(kaksTorture) kaks.torture <- read.alignment(file = system.file("sequences/kaks-torture.fasta", package = "seqinr"), format = "fasta") # # Failed on windows : # # stopifnot(identical(kaksTorture, kaks(kaks.torture))) # stopifnot(identical(kaksTorture, kaks(kaks.torture, rmgap = FALSE)))
Returns, for each database known by the server, its name (a valid value for the bank
argument of choosebank), availability (off means temporarily unavailable),
and description.
knowndbs(tag = c(NA, "TP", "TEST", "DEV"), socket = autosocket()) kdb(tag = c(NA, "TP", "TEST", "DEV"), socket = autosocket())knowndbs(tag = c(NA, "TP", "TEST", "DEV"), socket = autosocket()) kdb(tag = c(NA, "TP", "TEST", "DEV"), socket = autosocket())
tag |
default to NA, see details |
socket |
an object of class |
When the optional tag argument is used, only databases tagged with the given
string are listed;
when this argument is NA (by default), only untagged databases are listed.
The tag argument thus allows to identify series of special purpose (tagged) databases,
in addition to default (untagged) ones.
A dataframe with 3 columns:
bank |
string. Valid bank values known by the ACNUC server |
status |
string. "on" means available, "off" means temporarily unavailable |
info |
string. short description of the database |
J.R. Lobry
https://doua.prabi.fr/databases/acnuc.html
citation("seqinr")
The full list of untagged and tagged databases is here : https://doua.prabi.fr/databases/acnuc/banques_raa.php.
choosebank when called without arguments.
## Not run: ### Need internet connection choosebank("emblTP") kdb() closebank() ## End(Not run)## Not run: ### Need internet connection choosebank("emblTP") kdb() closebank() ## End(Not run)
This is just a shortcut for ls("package:seqinr")
lseqinr()lseqinr()
The list of objects in the package seqinr
Use library(help=seqinr) to have a summary of the functions available in the package.
J.R. Lobry
citation("seqinr")
lseqinr()lseqinr()
A fragment of the E. coli chromosome that was used in Lobry (1996) to show the change in GC skew at the origin of replication (i.e. the chirochore structure of bacterial chromosomes)
data(m16j)data(m16j)
A string of 1,616,539 characters
The sequence used in Lobry (1996) was a 1,616,174 bp fragment obtained from the concatenation of nine overlapping sequences (U18997, U00039, L10328, M87049, L19201, U00006, U14003, D10483, D26562. Ambiguities have been resolved since then and its was a chimeric sequence from K-12 strains MG1655 and W3110, the sequence used here is from strain MG1655 only (Blattner et al. 1997).
The chirochore structure of bacterial genomes is illustrated below by a screenshot of a part of figure 1 from Lobry (1996). See the example section to reproduce this figure.
Escherichia coli K-12 strain MG1655. Fragment from U00096 from the EBI Genome Reviews. Acnuc Release 7. Last Updated: Feb 26, 2007. XX DT 18-FEB-2004 (Rel. .1, Created) DT 09-JAN-2007 (Rel. 65, Last updated, Version 70) XX
Lobry, J.R. (1996) Asymmetric substitution patterns in the two DNA strands of
bacteria. Molecular Biology and Evolution, 13:660-665.
F.R. Blattner, G. Plunkett III, C.A. Bloch, N.T. Perna, V. Burland, M. Rilley,
J. Collado-Vides, J.D. Glasner, C.K. Rode, G.F. Mayhew, J. Gregor,
N.W. Davis, H.A. Kirkpatrick, M.A. Goeden, D.J. Rose, B. Mau, and
Y. Shao. (1997) The complete genome sequence of Escherichia coli K-12.
Science, 277:1453-1462
citation("seqinr")
# # Load data: # data(m16j) # # Define a function to compute the GC skew: # gcskew <- function(x) { if (!is.character(x) || length(x) > 1) stop("single string expected") tmp <- tolower(s2c(x)) nC <- sum(tmp == "c") nG <- sum(tmp == "g") if (nC + nG == 0) return(NA) return(100 * (nC - nG)/(nC + nG)) } # # Moving window along the sequence: # step <- 10000 wsize <- 10000 starts <- seq(from = 1, to = nchar(m16j), by = step) starts <- starts[-length(starts)] n <- length(starts) result <- numeric(n) for (i in seq_len(n)) { result[i] <- gcskew(substr(m16j, starts[i], starts[i] + wsize - 1)) } # # Plot the result: # xx <- starts/1000 yy <- result n <- length(result) hline <- 0 plot(yy ~ xx, type = "n", axes = FALSE, ann = FALSE, ylim = c(-10, 10)) polygon(c(xx[1], xx, xx[n]), c(min(yy), yy, min(yy)), col = "black", border = NA) usr <- par("usr") rect(usr[1], usr[3], usr[2], hline, col = "white", border = NA) lines(xx, yy) abline(h = hline) box() axis(1, at = seq(0, 1600, by = 200)) axis(2, las = 1) title(xlab = "position (Kbp)", ylab = "(C-G)/(C+G) [percent]", main = expression(paste("GC skew in ", italic(Escherichia~coli)))) arrows(860, 5.5, 720, 0.5, length = 0.1, lwd = 2) text(860, 5.5, "origin of replication", pos = 4)# # Load data: # data(m16j) # # Define a function to compute the GC skew: # gcskew <- function(x) { if (!is.character(x) || length(x) > 1) stop("single string expected") tmp <- tolower(s2c(x)) nC <- sum(tmp == "c") nG <- sum(tmp == "g") if (nC + nG == 0) return(NA) return(100 * (nC - nG)/(nC + nG)) } # # Moving window along the sequence: # step <- 10000 wsize <- 10000 starts <- seq(from = 1, to = nchar(m16j), by = step) starts <- starts[-length(starts)] n <- length(starts) result <- numeric(n) for (i in seq_len(n)) { result[i] <- gcskew(substr(m16j, starts[i], starts[i] + wsize - 1)) } # # Plot the result: # xx <- starts/1000 yy <- result n <- length(result) hline <- 0 plot(yy ~ xx, type = "n", axes = FALSE, ann = FALSE, ylim = c(-10, 10)) polygon(c(xx[1], xx, xx[n]), c(min(yy), yy, min(yy)), col = "black", border = NA) usr <- par("usr") rect(usr[1], usr[3], usr[2], hline, col = "white", border = NA) lines(xx, yy) abline(h = hline) box() axis(1, at = seq(0, 1600, by = 200)) axis(2, las = 1) title(xlab = "position (Kbp)", ylab = "(C-G)/(C+G) [percent]", main = expression(paste("GC skew in ", italic(Escherichia~coli)))) arrows(860, 5.5, 720, 0.5, length = 0.1, lwd = 2) text(860, 5.5, "origin of replication", pos = 4)
This data set gives an example of a protein alignment obtained after a call to the function read.alignment on an alignment file in "mase" format.
data(mase)data(mase)
A List of class alignment
http://www.clustal.org/
Faullcner.D.V. and Jurka,J. (1988) Multiple sequences alignment editor(MASE). Trends Biochem. Sa., 13, 321-322.
This function modifies a previously existing ACNUC list by selecting sequences either by length, either by date, either for the presence of a given string in annotations.
modifylist(listname, modlistname = listname, operation, type = c("length", "date", "scan"), socket = autosocket(), virtual = FALSE, verbose = FALSE)modifylist(listname, modlistname = listname, operation, type = c("length", "date", "scan"), socket = autosocket(), virtual = FALSE, verbose = FALSE)
listname |
the name of the ACNUC list to modify |
modlistname |
the name of the modified ACNUC list. Default is to use the same list name so that previous list is lost. |
operation |
a string of character describing the operation to be done, see details. |
type |
the type of operation, could be one of |
socket |
an object of class |
virtual |
if TRUE, no attempt is made to retrieve the information about all the elements of the list. In this case, the |
verbose |
logical, if TRUE mode verbose is on |
Example of possible values for the argument operation:
as in "> 10000" or "< 500"
as in "> 1/jul/2001" or "< 30/AUG/98"
specify the string to be searched for
Character < is to be understood as <= and > likewise.
The result is directly assigned to the object modlistname in the user workspace.
This is an objet of class qaw, a list with the following 6 components:
call |
the original call |
name |
the ACNUC list name |
nelem |
the number of elements (for instance sequences) in the ACNUC list |
typelist |
the type of the elements of the list. Could be SQ for a list of sequence names, KW for a list of keywords, SP for a list of species names. |
req |
a list of sequence names that fit the required criteria or |
socket |
the socket connection that was used |
J.R. Lobry
https://doua.prabi.fr/databases/acnuc.html
citation("seqinr")
choosebank, query and
prepgetannots to select the annotation lines for scan.
## Not run: # Need internet connection choosebank("emblTP") mylist <- query("mylist", "sp=felis catus et t=cds", virtual=TRUE) mylist$nelem # 603 sequences stopifnot(mylist$nelem == 603) # select sequences with at least 1000 bp: mylist <- modifylist("mylist", operation = ">1000", virtual = TRUE) mylist$nelem # now, only 132 sequences stopifnot(mylist$nelem == 132) # scan for "felis" in annotations: mylist <- modifylist("mylist", op = "felis", type = "scan", virtual = TRUE) mylist$nelem # now, only 33 sequences stopifnot(mylist$nelem == 33) # modify by date: mylist <- modifylist("mylist", op = "> 1/jul/2001", type = "date", virtual = TRUE) mylist$nelem # now, only 15 sequences stopifnot(mylist$nelem == 15) # Summary of current ACNUC lists, one list called MYLIST on sever: sapply(alr()$rank, getliststate) closebank() ## End(Not run)## Not run: # Need internet connection choosebank("emblTP") mylist <- query("mylist", "sp=felis catus et t=cds", virtual=TRUE) mylist$nelem # 603 sequences stopifnot(mylist$nelem == 603) # select sequences with at least 1000 bp: mylist <- modifylist("mylist", operation = ">1000", virtual = TRUE) mylist$nelem # now, only 132 sequences stopifnot(mylist$nelem == 132) # scan for "felis" in annotations: mylist <- modifylist("mylist", op = "felis", type = "scan", virtual = TRUE) mylist$nelem # now, only 33 sequences stopifnot(mylist$nelem == 33) # modify by date: mylist <- modifylist("mylist", op = "> 1/jul/2001", type = "date", virtual = TRUE) mylist$nelem # now, only 15 sequences stopifnot(mylist$nelem == 15) # Summary of current ACNUC lists, one list called MYLIST on sever: sapply(alr()$rank, getliststate) closebank() ## End(Not run)
Rename object from into to.
move(from, to) mv(from, to)move(from, to) mv(from, to)
from |
an R object name |
to |
the new R object name |
none.
J.R. Lobry
citation("seqinr")
# # Example in a new empty environment: # local({ zefplock <- pi print(ls()) print(zefplock) mv(zefplock, toto) print(ls()) print(toto) stopifnot(identical(toto, pi)) # Sanity check }) # # Check that self-affectation is possible: # mv(mv, mv) # force self-affectation for the function itself mv(mv, mv) # OK, function mv() still exists# # Example in a new empty environment: # local({ zefplock <- pi print(ls()) print(zefplock) mv(zefplock, toto) print(ls()) print(toto) stopifnot(identical(toto, pi)) # Sanity check }) # # Check that self-affectation is possible: # mv(mv, mv) # force self-affectation for the function itself mv(mv, mv) # OK, function mv() still exists
This data set gives an example of a protein alignment obtained after a call to the function read.alignment on an alignment file in "msf" format.
data(msf)data(msf)
A List of class alignment
http://www.ebi.ac.uk/2can/tutorials/formats.html#MSF/
By default, if no ‘levels’ arguments is provided, this function
will just transform your vector of integer into a DNA sequence
according to the lexical order: 0 -> "a", 1 -> "c", 2 -> "g",
3 -> "t", others -> NA.
n2s(nseq, levels = c("a", "c", "g", "t"), base4 = TRUE)n2s(nseq, levels = c("a", "c", "g", "t"), base4 = TRUE)
nseq |
A vector of integers |
levels |
the translation vector |
base4 |
when this logical is true, the numerical encoding of
|
a vector of characters
J.R. Lobry
citation("seqinr")
##example of the default behaviour: nseq <- sample(x = 0:3, size = 100, replace = TRUE) n2s(nseq) # Show what happens with out-of-range and NA values: nseq[1] <- NA nseq[2] <- 777 n2s(nseq)[1:10] # How to get an RNA instead: n2s(nseq, levels = c("a", "c", "g", "u"))##example of the default behaviour: nseq <- sample(x = 0:3, size = 100, replace = TRUE) n2s(nseq) # Show what happens with out-of-range and NA values: nseq[1] <- NA nseq[2] <- 777 n2s(nseq)[1:10] # How to get an RNA instead: n2s(nseq, levels = c("a", "c", "g", "u"))
This program finds the putative origin and terminus of replication in procaryotic genomes. The program discriminates between codon positions.
oriloc(seq.fasta = system.file("sequences/ct.fasta.gz", package = "seqinr"), g2.coord = system.file("sequences/ct.predict", package = "seqinr"), glimmer.version = 3, oldoriloc = FALSE, gbk = NULL, clean.tmp.files = TRUE, rot = 0)oriloc(seq.fasta = system.file("sequences/ct.fasta.gz", package = "seqinr"), g2.coord = system.file("sequences/ct.predict", package = "seqinr"), glimmer.version = 3, oldoriloc = FALSE, gbk = NULL, clean.tmp.files = TRUE, rot = 0)
seq.fasta |
Character: the name of a file which contains the DNA sequence
of a bacterial chromosome in fasta format. The default value,
|
g2.coord |
Character: the name of file which contains the output of
glimmer program ( |
glimmer.version |
Numeric: glimmer version used, could be 2 or 3 |
oldoriloc |
Logical: to be set at TRUE to reproduce the (deprecated) outputs of previous (publication date: 2000) version of the oriloc program. |
gbk |
Character: the URL of a file in GenBank format. When provided
|
clean.tmp.files |
Logical: if TRUE temporary files generated when working with a GenBank file are removed. |
rot |
Integer, with zero default value, used to permute circurlarly the genome. |
The method builds on the fact that there are compositional asymmetries between the leading and the lagging strand for replication. The programs works only with third codon positions so as to increase the signal/noise ratio. To discriminate between codon positions, the program use as input either an annotated genbank file, either a fasta file and a glimmer2.0 (or glimmer3.0) output file.
A data.frame with seven columns: g2num for the CDS number in
the g2.coord file, start.kb for the start position of CDS
expressed in Kb (this is the position of the first occurence of a
nucleotide in a CDS regardless of its orientation), end.kb
for the last position of a CDS, CDS.excess for the DNA walk for
gene orientation (+1 for a CDS in the direct strand, -1 for a CDS in
the reverse strand) cummulated over genes, skew for the cummulated
composite skew in third codon positions, x for the cummulated
T - A skew in third codon position, y for the cummulated C - G
skew in third codon positions.
The method works only for genomes having a single origin of replication from which the replication is bidirectional. To detect the composition changes, a DNA-walk is performed. In a 2-dimensional DNA walk, a C in the sequence corresponds to the movement in the positive y-direction and G to a movement in the negative y-direction. T and A are mapped by analogous steps along the x-axis. When there is a strand asymmetry, this will form a trajectory that turns at the origin and terminus of replication. Each step is the sum of nucleotides in a gene in third codon positions. Then orthogonal regression is used to find a line through this trajectory. Each point in the trajectory will have a corresponding point on the line, and the coordinates of each are calculated. Thereafter, the distances from each of these points to the origin (of the plane), are calculated. These distances will represent a form of cumulative skew. This permets us to make a plot with the gene position (gene number, start or end position) on the x-axis and the cumulative skew (distance) at the y-axis. Depending on where the sequence starts, such a plot will display one or two peaks. Positive peak means origin, and negative means terminus. In the case of only one peak, the sequence starts at the origin or terminus site.
J.R. Lobry, A.C. Frank
The original paper for oriloc:
Frank, A.C., Lobry, J.R. (2000) Oriloc: prediction of replication
boundaries in unannotated bacterial chromosomes. Bioinformatics,
16:566-567.
doi:10.1093/bioinformatics/16.6.560
A simple informal introduction to DNA-walks:
Lobry, J.R. (1999) Genomic landscapes. Microbiology Today,
26:164-165.
https://seqinr.r-forge.r-project.org/MicrTod_1999_26_164.pdf
An early and somewhat historical application of DNA-walks:
Lobry, J.R. (1996) A simple vectorial representation of DNA sequences
for the detection of replication origins in bacteria. Biochimie,
78:323-326.
Glimmer, a very efficient open source software for the prediction of CDS from scratch
in prokaryotic genome, is decribed at http://ccb.jhu.edu/software/glimmer/index.shtml.
For a description of Glimmer 1.0 and 2.0 see:
Delcher, A.L., Harmon, D., Kasif, S., White, O., Salzberg, S.L. (1999)
Improved microbial gene identification with GLIMMER,
Nucleic Acids Research, 27:4636-4641.
Salzberg, S., Delcher, A., Kasif, S., White, O. (1998)
Microbial gene identification using interpolated Markov models,
Nucleic Acids Research, 26:544-548.
citation("seqinr")
draw.oriloc, rearranged.oriloc
## Not run: # # A little bit too long for routine checks because oriloc() is already # called in draw.oriloc.Rd documentation file. Try example(draw.oriloc) # instead, or copy/paste the following code: # out <- oriloc() plot(out$st, out$sk, type = "l", xlab = "Map position in Kb", ylab = "Cumulated composite skew", main = expression(italic(Chlamydia~~trachomatis)~~complete~~genome)) # # Example with a single GenBank file: # out2 <- oriloc(gbk="https://pbil.univ-lyon1.fr/datasets/seqinr/data/ct.gbk") draw.oriloc(out2) # # (some warnings are generated because of join in features and a gene that # wrap around the genome) # ## End(Not run)## Not run: # # A little bit too long for routine checks because oriloc() is already # called in draw.oriloc.Rd documentation file. Try example(draw.oriloc) # instead, or copy/paste the following code: # out <- oriloc() plot(out$st, out$sk, type = "l", xlab = "Map position in Kb", ylab = "Cumulated composite skew", main = expression(italic(Chlamydia~~trachomatis)~~complete~~genome)) # # Example with a single GenBank file: # out2 <- oriloc(gbk="https://pbil.univ-lyon1.fr/datasets/seqinr/data/ct.gbk") draw.oriloc(out2) # # (some warnings are generated because of join in features and a gene that # wrap around the genome) # ## End(Not run)
Answers from server looks like : "code=0&lrank=2&count=150513&type=SQ&locus=F".
parser.socket(onelinefromserver, verbose = FALSE)parser.socket(onelinefromserver, verbose = FALSE)
onelinefromserver |
a string |
verbose |
logical, if TRUE mode verbose is on |
A vector of mode character or NULL if onelinefromserver is NULL
or if its length is 0.
J.R. Lobry
citation("seqinr")
stopifnot(all(parser.socket("code=0&lrank=2&count=150513&type=SQ&locus=F") == c("0", "2", "150513", "SQ", "F")))stopifnot(all(parser.socket("code=0&lrank=2&count=150513&type=SQ&locus=F") == c("0", "2", "150513", "SQ", "F")))
Simple peak location for data imported with the read.abif function
using cubic spline interpolation.
peakabif(abifdata, chanel, npeak, thres = 400/yscale, fig = TRUE, chanel.names = c(1:4,105), DATA = paste("DATA", chanel.names[chanel], sep = "."), tmin = 1/tscale, tmax = abifdata$Data[["SCAN.1"]]/tscale, tscale = 1000, yscale = 1000, irange = (tmin*tscale):(tmax*tscale), y = abifdata$Data[[DATA]][irange]/yscale, method = "monoH.FC", maxrfu = 1000, ...)peakabif(abifdata, chanel, npeak, thres = 400/yscale, fig = TRUE, chanel.names = c(1:4,105), DATA = paste("DATA", chanel.names[chanel], sep = "."), tmin = 1/tscale, tmax = abifdata$Data[["SCAN.1"]]/tscale, tscale = 1000, yscale = 1000, irange = (tmin*tscale):(tmax*tscale), y = abifdata$Data[[DATA]][irange]/yscale, method = "monoH.FC", maxrfu = 1000, ...)
abifdata |
the result returned by |
chanel |
the dye number |
npeak |
the expected number of peaks |
thres |
scaled threshold value |
fig |
logical: should localized peaks be plotted |
chanel.names |
numbers extensions used for the DATA |
DATA |
names of the DATA components |
tmin |
scaled starting time for the time axis |
tmax |
scaled ending time for the time axis |
tscale |
scale factor for the time axis |
yscale |
scale factor for the y-axis (RFU) |
irange |
indices of data to be plotted |
y |
values used for the y-axis |
method |
method to be used by |
maxrfu |
argument passed to |
... |
arguments forwarded to |
Returns invisibly a list with the unscaled values for the locations of peaks, heights of peaks and surfaces of peaks and baseline estimate. The peak location are in datapoint units, that is an integer starting at 1 for the first experimental point, 2 for the second experimental point, etc. However, due to interpolation between points the estimated peak location is usually not an integer.
J.R. Lobry
citation("seqinr")
function read.abif to import files in ABIF format,
plotabif to plot them,
data gs500liz for internal size standards,
data identifiler for allele names in the allelic ladder,
data JLO for an example of an individual sample file,
data ECH for an example of an allelic lader.
data(JLO) JLO.maxis <- peakabif(JLO, 5, npeak = 14, tmin = 2.7, thres = 0.1)$maxisdata(JLO) JLO.maxis <- peakabif(JLO, 5, npeak = 14, tmin = 2.7, thres = 0.1)$maxis
Generates a random permutation of a given sequence, according to a
given model. Available models are : base, position,
codon, syncodon.
permutation(sequence,modele='base',frame=0, replace=FALSE,prot=FALSE,numcode=1,ucoweight = NULL)permutation(sequence,modele='base',frame=0, replace=FALSE,prot=FALSE,numcode=1,ucoweight = NULL)
sequence |
A nucleic acids sequence |
modele |
A string of characters describing the model chosen for the random generation |
frame |
Only active for the |
replace |
This option is not active for the |
prot |
Only available for the |
numcode |
Only available for the |
ucoweight |
A list of weights containing the desired codon usage
bias as generated by |
The base model allows for random sequence generation by
shuffling (with/without replacement) of all bases in the sequence.
The position model allows for random sequence generation
by shuffling (with/without replacement) of bases within their
position in the codon (bases in position I, II or III stay in
position I, II or III in the new sequence.
The codon model allows for random sequence generation by
shuffling (with/without replacement) of codons.
The syncodon model allows for random sequence generation
by shuffling (with/without replacement) of synonymous codons.
a sequence generated from the original one by a given model
L. Palmeira
citation("seqinr")
data(ec999) sequence=ec999[1][[1]] new=permutation(sequence,modele='base') identical(all.equal(count(new,1),count(sequence,1)),TRUE) new=permutation(sequence,modele='position') identical(all.equal(GC(new),GC(sequence)),TRUE) identical(all.equal(GC2(new),GC2(sequence)),TRUE) identical(all.equal(GC3(new),GC3(sequence)),TRUE) new=permutation(sequence,modele='codon') identical(all.equal(uco(new),uco(sequence)),TRUE) new=permutation(sequence,modele='syncodon',numcode=1) identical(all.equal(translate(new),translate(sequence)),TRUE)data(ec999) sequence=ec999[1][[1]] new=permutation(sequence,modele='base') identical(all.equal(count(new,1),count(sequence,1)),TRUE) new=permutation(sequence,modele='position') identical(all.equal(GC(new),GC(sequence)),TRUE) identical(all.equal(GC2(new),GC2(sequence)),TRUE) identical(all.equal(GC3(new),GC3(sequence)),TRUE) new=permutation(sequence,modele='codon') identical(all.equal(uco(new),uco(sequence)),TRUE) new=permutation(sequence,modele='syncodon',numcode=1) identical(all.equal(translate(new),translate(sequence)),TRUE)
This data set gives an example of a amino acids alignment obtained after a call to the function read.alignment on an alignment file in "phylip" format.
data(phylip)data(phylip)
A List of class alignment
http://evolution.genetics.washington.edu/phylip.html
http://evolution.genetics.washington.edu/phylip.html
This compilation of pK values is from Joanna Kiraga (2008).
data(pK)data(pK)
A data frame with the seven charged amino-acid in row and six sources in column. The rownames are the one-letter code for amino-acids.
Table 2 in Kiraga (2008).
Kiraga, J. (2008) Analysis and computer simulations of variability of isoelectric point of proteins in the proteomes. PhD thesis, University of Wroclaw, Poland.
Bjellqvist, B., Hughes, G.J., Pasquali, Ch., Paquet, N., Ravier, F., Sanchez, J.Ch., Frutige,r S., Hochstrasser D. (1993) The focusing positions of polypeptides in immobilized pH gradients can be predicted from their amino acid sequences. Electrophoresis, 14:1023-1031.
EMBOSS data were from release 5.0 and were still the same in release 6.6 https://emboss.sourceforge.net/apps/release/6.6/emboss/apps/iep.html last visited 2016-06-03.
Murray, R.K., Granner, D.K., Rodwell, V.W. (2006) Harper's illustrated Biochemistry. 27th edition. Published by The McGraw-Hill Companies.
Sillero, A., Maldonado, A. (2006) Isoelectric point determination of proteins and other macromolecules: oscillating method. Comput Biol Med., 36:157-166.
Solomon, T.W.G. (1998) Fundamentals of Organic Chemistry, 5th edition. Published by Wiley.
Stryer L. (1999) Biochemia. czwarta edycja. Wydawnictwo Naukowe PWN.
citation("seqinr")
data(pK) data(SEQINR.UTIL) # for N and C terminal pK values prot <- s2c("ACDEFGHIKLMNPQRSTVWY") compoAA <- table(factor(prot, levels = LETTERS)) nTermR <- which(LETTERS == prot[1]) cTermR <- which(LETTERS == prot[length(seq)]) computeCharge <- function(pH, compoAA, pK, nTermResidue, cTermResidue){ cter <- 10^(-SEQINR.UTIL$pk[cTermResidue,1]) / (10^(-SEQINR.UTIL$pk[cTermResidue,1]) + 10^(-pH)) nter <- 10^(-pH) / (10^(-SEQINR.UTIL$pk[nTermResidue,2]) + 10^(-pH)) carg <- as.vector(compoAA['R'] * 10^(-pH) / (10^(-pK['R']) + 10^(-pH))) chis <- as.vector(compoAA['H'] * 10^(-pH) / (10^(-pK['H']) + 10^(-pH))) clys <- as.vector(compoAA['K'] * 10^(-pH) / (10^(-pK['K']) + 10^(-pH))) casp <- as.vector(compoAA['D'] * 10^(-pK['D']) /(10^(-pK['D']) + 10^(-pH))) cglu <- as.vector(compoAA['E'] * 10^(-pK['E']) / (10^(-pK['E']) + 10^(-pH))) ccys <- as.vector(compoAA['C'] * 10^(-pK['C']) / (10^(-pK['C']) + 10^(-pH))) ctyr <- as.vector(compoAA['Y'] * 10^(-pK['Y']) / (10^(-pK['Y']) + 10^(-pH))) charge <- carg + clys + chis + nter - (casp + cglu + ctyr + ccys + cter) return(charge) } pHseq <- seq(from = 0, to = 14, by = 0.1) Bje <- pK$Bjellqvist names(Bje) <- rownames(pK) res <- computeCharge(pHseq, compoAA, Bje, nTermR, cTermR) plot(pHseq, res, type = "l", ylab = "Charge", las = 1, main = paste("Charge of protein\n",c2s(prot)), xlab = "pH") for(j in 2:ncol(pK)){ src <- pK[,j] names(src) <- rownames(pK) res <- computeCharge(pHseq, compoAA, src, nTermR, cTermR) lines(pHseq, res, lty = j, col = rainbow(5)[j]) } abline(h=0) abline(v=computePI(prot)) legend("bottomleft", inset = 0.01, colnames(pK), lty = 1:6, col = c("black", rainbow(5)))data(pK) data(SEQINR.UTIL) # for N and C terminal pK values prot <- s2c("ACDEFGHIKLMNPQRSTVWY") compoAA <- table(factor(prot, levels = LETTERS)) nTermR <- which(LETTERS == prot[1]) cTermR <- which(LETTERS == prot[length(seq)]) computeCharge <- function(pH, compoAA, pK, nTermResidue, cTermResidue){ cter <- 10^(-SEQINR.UTIL$pk[cTermResidue,1]) / (10^(-SEQINR.UTIL$pk[cTermResidue,1]) + 10^(-pH)) nter <- 10^(-pH) / (10^(-SEQINR.UTIL$pk[nTermResidue,2]) + 10^(-pH)) carg <- as.vector(compoAA['R'] * 10^(-pH) / (10^(-pK['R']) + 10^(-pH))) chis <- as.vector(compoAA['H'] * 10^(-pH) / (10^(-pK['H']) + 10^(-pH))) clys <- as.vector(compoAA['K'] * 10^(-pH) / (10^(-pK['K']) + 10^(-pH))) casp <- as.vector(compoAA['D'] * 10^(-pK['D']) /(10^(-pK['D']) + 10^(-pH))) cglu <- as.vector(compoAA['E'] * 10^(-pK['E']) / (10^(-pK['E']) + 10^(-pH))) ccys <- as.vector(compoAA['C'] * 10^(-pK['C']) / (10^(-pK['C']) + 10^(-pH))) ctyr <- as.vector(compoAA['Y'] * 10^(-pK['Y']) / (10^(-pK['Y']) + 10^(-pH))) charge <- carg + clys + chis + nter - (casp + cglu + ctyr + ccys + cter) return(charge) } pHseq <- seq(from = 0, to = 14, by = 0.1) Bje <- pK$Bjellqvist names(Bje) <- rownames(pK) res <- computeCharge(pHseq, compoAA, Bje, nTermR, cTermR) plot(pHseq, res, type = "l", ylab = "Charge", las = 1, main = paste("Charge of protein\n",c2s(prot)), xlab = "pH") for(j in 2:ncol(pK)){ src <- pK[,j] names(src) <- rownames(pK) res <- computeCharge(pHseq, compoAA, src, nTermR, cTermR) lines(pHseq, res, lty = j, col = rainbow(5)[j]) } abline(h=0) abline(v=computePI(prot)) legend("bottomleft", inset = 0.01, colnames(pK), lty = 1:6, col = c("black", rainbow(5)))
This function plots all the type of subsequences on a parent sequence. Subsequences are represented by colored rectangle on the parent sequence. For example, types could be CDS, TRNA, RRNA .... In order to get all the types that are available for the selected database, use getType.
## S3 method for class 'SeqAcnucWeb' plot(x, types = getType()$sname, socket = autosocket(), ...)## S3 method for class 'SeqAcnucWeb' plot(x, types = getType()$sname, socket = autosocket(), ...)
x |
A sequence of class |
types |
The type of subsequences to plot. Default value is to consider all possible subsequence types. |
socket |
an object of class |
... |
not currently used |
An invisible list giving, for each subsequence, its position on the parent sequence.
D. Charif, J.R. Lobry
https://doua.prabi.fr/databases/acnuc.html
citation("seqinr")
## Not run: ### Need internet connection choosebank("emblTP") mylist <- query("mylist", "AC=AB078009") plot(mylist$req[[1]]) ## End(Not run)## Not run: ### Need internet connection choosebank("emblTP") mylist <- query("mylist", "AC=AB078009") plot(mylist$req[[1]]) ## End(Not run)
Simple chromatogram plot for data imported with the read.abif function.
plotabif(abifdata, chanel = 1, tmin = 1/tscale, tmax = abifdata$Data[["SCAN.1"]]/tscale, tscale = 1000, yscale = 1000, type = "l", las = 1, xlab = paste("Time", tscale, sep = "/"), ylab = paste("RFU", yscale, sep = "/"), irange = (tmin*tscale):(tmax*tscale), x = irange/tscale, xlim = c(tmin, tmax), chanel.names = c(1:4,105), DATA = paste("DATA", chanel.names[chanel], sep = "."), y = abifdata$Data[[DATA]][irange]/yscale, ylim = c(min(y), max(y)), dyn = abifdata$Data[[paste("DyeN", chanel, sep = ".")]], main = paste(deparse(substitute(abifdata)), chanel, dyn, sep = " ; "), calibr = NULL, ladder.bp = NULL, allele.names = "identifiler", ladder.lab = TRUE, ...)plotabif(abifdata, chanel = 1, tmin = 1/tscale, tmax = abifdata$Data[["SCAN.1"]]/tscale, tscale = 1000, yscale = 1000, type = "l", las = 1, xlab = paste("Time", tscale, sep = "/"), ylab = paste("RFU", yscale, sep = "/"), irange = (tmin*tscale):(tmax*tscale), x = irange/tscale, xlim = c(tmin, tmax), chanel.names = c(1:4,105), DATA = paste("DATA", chanel.names[chanel], sep = "."), y = abifdata$Data[[DATA]][irange]/yscale, ylim = c(min(y), max(y)), dyn = abifdata$Data[[paste("DyeN", chanel, sep = ".")]], main = paste(deparse(substitute(abifdata)), chanel, dyn, sep = " ; "), calibr = NULL, ladder.bp = NULL, allele.names = "identifiler", ladder.lab = TRUE, ...)
abifdata |
the result returned by |
chanel |
the dye number |
tmin |
scaled starting time for the time axis |
tmax |
scaled ending time for the time axis |
tscale |
scale factor for the time axis |
yscale |
scale factor for the y-axis (RFU) |
type |
type of line drawing forwarded to |
las |
orientation of axis labels forwarded to |
xlab |
x-axis label forwarded to |
ylab |
y-axis label forwarded to |
irange |
indices of data to be plotted |
x |
values used for the x-axis |
xlim |
limits for the x-axis forwarded to |
chanel.names |
numbers extensions used for the DATA |
DATA |
names of the DATA components |
y |
values used for the y-axis |
ylim |
limits for the y-axis forwarded to |
dyn |
dye name |
main |
title for the plot forwarded to |
calibr |
an optional calibration function to convert time into bp |
ladder.bp |
an optional ladder scale in bp (calibr must be provided) |
allele.names |
name of the dataset with allele names |
ladder.lab |
logical: should allele names be added on plot |
... |
arguments forwarded to |
Returns invisibly its local graphical parameter settings.
J.R. Lobry
citation("seqinr")
function read.abif to import files in ABIF format,
data gs500liz for internal size standards,
data identifiler for allele names in the allelic ladder,
data JLO for an example of an individual sample file,
data ECH for an example of an allelic lader.
data(ECH) plotabif(ECH,chanel = 1, tmin = 3.2, tmax = 6.1)data(ECH) plotabif(ECH,chanel = 1, tmin = 3.2, tmax = 6.1)
Simple representation of an observed allelic ladder.
plotladder(abifdata, chanel, calibr, allele.names = "identifiler", npeak = NULL, ...)plotladder(abifdata, chanel, calibr, allele.names = "identifiler", npeak = NULL, ...)
abifdata |
the result returned by |
chanel |
the dye number |
calibr |
a mandatory calibration function to convert time into bp |
allele.names |
name of the dataset which contains allele names as in |
npeak |
expected number of peaks, deduced from |
... |
arguments forwarded to |
Returns invisibly the location of peaks in bp.
J.R. Lobry
citation("seqinr")
function read.abif to import files in ABIF format,
plotabif to plot them,
data gs500liz for internal size standards,
data identifiler for allele names in the allelic ladder,
data JLO for an example of an individual sample file,
data ECH for an example of an allelic lader.
# # load an example of allelic ladder results from an ABIF (*.fsa) file: # data(ECH) # # Extract from internal size standard chanel number 5 the location # of 14 peaks: # ECH.maxis <- peakabif(ECH, 5, npeak = 14, tmin = 2.7, thres = 0.1, fig = FALSE)$maxis # # Load data about the expected size of peaks in bp for calibration: # data(gs500liz) lizbp <- gs500liz$liz # All peaks size in bp lizbp[!gs500liz$mask1 | !gs500liz$mask2] <- NA # Mark useless peaks lizbp <- lizbp[-c(1,2)] # The first two peaks are not extracted from ECH ECH.calibr <- splinefun(ECH.maxis[!is.na(lizbp)], lizbp[!is.na(lizbp)]) # # Show the allelic ladder for the 4 dyes: # plotladder(ECH, 1, ECH.calibr, tmin = 3.1, thres = 0.3, fig = FALSE) plotladder(ECH, 2, ECH.calibr, tmin = 3.1, thres = 0.35, fig = FALSE) plotladder(ECH, 3, ECH.calibr, tmin = 3.1, thres = 0.2, fig = FALSE) plotladder(ECH, 4, ECH.calibr, tmin = 3.1, thres = 0.2, fig = FALSE)# # load an example of allelic ladder results from an ABIF (*.fsa) file: # data(ECH) # # Extract from internal size standard chanel number 5 the location # of 14 peaks: # ECH.maxis <- peakabif(ECH, 5, npeak = 14, tmin = 2.7, thres = 0.1, fig = FALSE)$maxis # # Load data about the expected size of peaks in bp for calibration: # data(gs500liz) lizbp <- gs500liz$liz # All peaks size in bp lizbp[!gs500liz$mask1 | !gs500liz$mask2] <- NA # Mark useless peaks lizbp <- lizbp[-c(1,2)] # The first two peaks are not extracted from ECH ECH.calibr <- splinefun(ECH.maxis[!is.na(lizbp)], lizbp[!is.na(lizbp)]) # # Show the allelic ladder for the 4 dyes: # plotladder(ECH, 1, ECH.calibr, tmin = 3.1, thres = 0.3, fig = FALSE) plotladder(ECH, 2, ECH.calibr, tmin = 3.1, thres = 0.35, fig = FALSE) plotladder(ECH, 3, ECH.calibr, tmin = 3.1, thres = 0.2, fig = FALSE) plotladder(ECH, 4, ECH.calibr, tmin = 3.1, thres = 0.2, fig = FALSE)
Plot amplicon size ranges grouped by dye color.
plotPanels(kitname, data, xlim = NULL, cex = 0.75, alpha = 0.5)plotPanels(kitname, data, xlim = NULL, cex = 0.75, alpha = 0.5)
kitname |
string of characters for the kit name. |
data |
an output from the |
xlim |
x-axis range. |
cex |
character expansion factor. |
alpha |
alpha transparency chanel for colors. |
none
J.R. Lobry
path1 <- system.file("abif/AmpFLSTR_Panels_v1.txt", package = "seqinr") res1 <- readPanels(path1) par(mfrow = c(2,1)) plotPanels("Identifiler_v1", res1) plotPanels("SEfiler_v1", res1)path1 <- system.file("abif/AmpFLSTR_Panels_v1.txt", package = "seqinr") res1 <- readPanels(path1) par(mfrow = c(2,1)) plotPanels("Identifiler_v1", res1) plotPanels("SEfiler_v1", res1)
With default parameter values, returns the apparent molecular weight of one mole (6.0221415 e+23) of the input protein expressed in gram at see level on Earth with terrestrial isotopic composition.
pmw(seqaa, Ar = c(C = 12.0107, H = 1.00794, O = 15.9994, N = 14.0067, P = 30.973762, S = 32.065), gravity = 9.81, unit = "gram", checkseqaa = TRUE)pmw(seqaa, Ar = c(C = 12.0107, H = 1.00794, O = 15.9994, N = 14.0067, P = 30.973762, S = 32.065), gravity = 9.81, unit = "gram", checkseqaa = TRUE)
seqaa |
a protein sequence as a vector of single chars. Allowed values are "*ACDEFGHIKLMNPQRSTVWY", non allowed values are ignored. |
Ar |
a named vector for the mean relative atomic masses of CHONPS atoms. Defaults values are from to the natural terrestrial sources according to the 43rd IUPAC General Assembly in Beijing, China in August 2005 (See https://iupac.org/category/recent-releases/ for updates). |
gravity |
gravitational field constant in standard units. Defaults to 9.81 m/s2, that is to the average value at see level on Earth. Negative values are not allowed. |
unit |
a string that could be "gram" to get the result in grams (1 g = 0.001 kg) or "N" to get the result in Newton units (1 N = 1 kg.m/s2). |
checkseqaa |
if TRUE |
Computing the molecular mass of a protein is close to a linear form on amino-acid frequencies, but not exactly since we have to remove n - 1 water molecules for peptidic bound formation.
All cysteines are supposed to be in reduced (-SH) form.
All methionines are supposed to be not oxidized.
No post-traductional modifications (such as phosphorylations) are taken into account.
Rare amino-acids (pyrolysine and selenocysteine) are not handled.
Do not use defaults values for Ar to compute the molecular mass of alien's proteins: the isotopic composition for CHONPS atoms could be different from terrestrial data in a xenobiotic context. Some aliens are easily offended, make sure not to initiate one more galactic war by repporting wrong results.
The protein molecular weight as a single numeric value.
J.R. Lobry
citation("seqinr")
allowed <- s2c("*ACDEFGHIKLMNPQRSTVWY") # All allowed chars in a protein pmw(allowed) all.equal(pmw(allowed), 2395.71366) # Should be true on most platforms # # Compute the apparent molecular weight on Moon surface: # pmw(allowed, g = 1.6) # # Compute the apparent molecular weight in absence of gravity: # pmw(allowed, g = 0) # should be zero # # Reports results in Newton units: # pmw(allowed, unit = "N") # # Compute the mass in kg of one mol of this protein: # pmw(allowed)/10^3 # # Compute the mass for all amino-acids: # sapply(allowed[-1], pmw) -> aamw names(aamw) <- aaa(names(aamw)) aamwallowed <- s2c("*ACDEFGHIKLMNPQRSTVWY") # All allowed chars in a protein pmw(allowed) all.equal(pmw(allowed), 2395.71366) # Should be true on most platforms # # Compute the apparent molecular weight on Moon surface: # pmw(allowed, g = 1.6) # # Compute the apparent molecular weight in absence of gravity: # pmw(allowed, g = 0) # should be zero # # Reports results in Newton units: # pmw(allowed, unit = "N") # # Compute the mass in kg of one mol of this protein: # pmw(allowed)/10^3 # # Compute the mass for all amino-acids: # sapply(allowed[-1], pmw) -> aamw names(aamw) <- aaa(names(aamw)) aamw
This function is called before using getAnnot or
modifylist with a scan type operation to
select the annotation lines to be returned or scanned.
prepgetannots(what = "all", setfor = c("scan", "getannots"), socket = autosocket(), verbose = FALSE) pga(what = "all", setfor = c("scan", "getannots"), socket = autosocket(), verbose = FALSE)prepgetannots(what = "all", setfor = c("scan", "getannots"), socket = autosocket(), verbose = FALSE) pga(what = "all", setfor = c("scan", "getannots"), socket = autosocket(), verbose = FALSE)
what |
the default "all" means that all annotation lines are selected. This can be more specific, see details. |
setfor |
this is used when |
socket |
an object of class |
verbose |
logical, if TRUE mode verbose is on |
The names of annotation lines in the opened ACNUC database is
returned by countfreelists, they are forced to upper
case letters by prepgetannots when supplied with the
what argument.
For the EMBL/SWISSPROT format, keys are: ALL, AC, DT, KW, OS, OC, OG, OH, RN, RC, RP, RX, RA, RG, RT, RL, DR, AH, AS, CC, FH, FT, SQ, SEQ.
For GenBank: ALL, ACCESSION, VERSION, KEYWORDS, SOURCE, ORGANISM, REFERENCE, AUTHORS, CONSRTM, TITLE, JOURNAL, PUBMED, REMARK, COMMENT, FEATURES, ORIGIN, SEQUENCE.
For FT (embl, swissprot) and FEATURES (GenBank), one or more specific feature keys can be specified using lines with only uppercase and such as
FEATURES|CDS FT|TRNA
Keys ALL and SEQ/SEQUENCE stand for all annotation and sequence lines, respectively. For the scan operation, key ALL stand for the DE/DEFINITION lines, and SEQ/SEQUENCE cannot be used (annotations but not sequence are scanned).
The function returns invisibly the annotation lines names.
J.R. Lobry
citation("seqinr")
getAnnot, modifylist, countfreelists
## Not run: # Need internet connection choosebank("genbank") mylist <- query("mylist","n=AQF16SRRN") pga() # We want to scan all annotations, including FEATURES mylist <- modifylist("mylist", operation = "strain", type = "scan") mylist$nelem # should be 1 ## End(Not run)## Not run: # Need internet connection choosebank("genbank") mylist <- query("mylist","n=AQF16SRRN") pga() # We want to scan all annotations, including FEATURES mylist <- modifylist("mylist", operation = "strain", type = "scan") mylist$nelem # should be 1 ## End(Not run)
To get a text representation of sequence of rank num and of its subsequences,
with bpl bases per line (default = 60), and with optional translation of
protein-coding subsequences
prettyseq(num, bpl = 60, translate = TRUE, socket = autosocket())prettyseq(num, bpl = 60, translate = TRUE, socket = autosocket())
num |
rank of the sequence in the ACNUC database |
bpl |
number of base per line |
translate |
should coding sequences be translated? |
socket |
an object of class |
An invisible vector of string. The output is redirected to the console.
J.R. Lobry
https://doua.prabi.fr/databases/acnuc.html
citation("seqinr")
## Not run: ### Need internet connection choosebank("emblTP") prettyseq(111) ## End(Not run)## Not run: ### Need internet connection choosebank("emblTP") prettyseq(111) ## End(Not run)
Print the number of elements, their type and the corresponding query.
## S3 method for class 'qaw' print(x, ...)## S3 method for class 'qaw' print(x, ...)
x |
A objet of class |
... |
not used |
None.
J.R. Lobry
citation("seqinr")
## Not run: ### Need internet connection choosebank("emblTP") list1 <- query("sp=felis catus") list1 # 4732 SQ for sp=felis catus ## End(Not run)## Not run: ### Need internet connection choosebank("emblTP") list1 <- query("sp=felis catus") list1 # 4732 SQ for sp=felis catus ## End(Not run)
Print the name, length, frame and genetic code number.
## S3 method for class 'SeqAcnucWeb' print(x, ...)## S3 method for class 'SeqAcnucWeb' print(x, ...)
x |
A sequence of class |
... |
Arguments passed to |
None.
J.R. Lobry
citation("seqinr")
## Not run: ### Need internet connection choosebank("emblTP") mylist <- query("mylist", "sp=felis catus") mylist$req[[1]] # name length frame ncbigc # "A06937" "34" "0" "1" ## End(Not run)## Not run: ### Need internet connection choosebank("emblTP") mylist <- query("mylist", "sp=felis catus") mylist$req[[1]] # name length frame ncbigc # "A06937" "34" "0" "1" ## End(Not run)
This dataset contains the zscores computed with the codon model on all CDS from 3 strains of Procholorococcus marinus (as retrieved from Genome Reviews database on June 16, 2005)
data(prochlo)data(prochlo)
List of three dataframes of the zscore of each of the 16 dinucleotides on each CDS retrieved from the specific strain.
strain adapted to living at a depth of 5
meters (high levels of UV exposure)
base model on each intergenic sequence
strain adapted to living at a depth of 120 meters (low levels of UV exposure)
strain adapted to living at a depth of 135 meters (low levels of UV exposure)
Palmeira, L., Guéguen, L. and Lobry JR. (2006) UV-targeted dinucleotides
are not depleted in light-exposed Prokaryotic genomes.
Molecular Biology and Evolution,
23:2214-2219.
doi:10.1093/molbev/msl096
citation("seqinr")
# # Show the four YpY for the three ecotypes: # data(prochlo) oneplot <- function(x){ plot(density(prochlo$BX548174[, x]), ylim = c(0,0.4), xlim = c(-4,4), lty=3, main = paste(substr(x,1,1), "p", substr(x,2,2), " bias", sep = ""), xlab="",ylab="",las=1, type = "n") rect(-10,-1,-1.96,10, col = "yellow", border = "yellow") rect(1.96,-1,10,10, col = "yellow", border = "yellow") lines(density(prochlo$BX548174[, x]),lty=3) lines(density(prochlo$AE017126[, x]),lty=2) lines(density(prochlo$BX548175[, x]),lty=1) abline(v=c(-1.96,1.96),lty=5) box() } par(mfrow=c(2,2),mar=c(2,3,2,0.5) + 0.1) oneplot("CT") oneplot("TC") oneplot("CC") oneplot("TT") # # Show YpY biases with respect to light exposure # curdev <- getOption("device") OK <- FALSE devlist <- c("X11", "windows", "quartz") # interactive with width and height in inches for(i in devlist){ if(exists(i) && identical(get(i), curdev)){ OK <- TRUE break } } if(OK){ curdev(width = 18, height = 11) par(oma = c(0, 0, 3, 0), mfrow = c(1, 2), mar = c(5, 4, 0, 0), cex = 1.5) example(waterabs, ask = FALSE) #left figure par(mar = c(5, 0, 0, 2)) plot(seq(-5, 3, by = 1), seq(0, 150, length = 9), col = "white", ann = FALSE, axes = FALSE, xaxs = "i", yaxs = "i") axis(1, at = c(-1.96, 0, 1.96), labels = c(-1.96, 0, 1.96)) lines(rep(-1.96, 2),c(0, 150),lty=2) lines(rep(1.96, 2), c(0, 150),lty=2) title(xlab = "zscore distribution", cex = 1.5, adj = 0.65) selcol <- c(6, 8, 14, 16) z5 <- prochlo$BX548174[, selcol] z120 <- prochlo$AE017126[, selcol] z135 <- prochlo$BX548175[, selcol] todo <- function(who, xx, col = "black", bottom, loupe){ dst <- density(who[, xx]) sel <- which(dst$x >= -3) lines(dst$x[sel], dst$y[sel]*loupe + (bottom), col = col) } todo2 <- function(who, bottom, loupe){ todo(who, "CC", "blue", bottom, loupe) todo(who, "CT", "red", bottom, loupe) todo(who, "TC", "green", bottom, loupe) todo(who, "TT", "black", bottom, loupe) } todo3 <- function(bottom, who, leg, loupe = 90){ lines(c(-5,-3), c(150 - leg, bottom + 20)) rect(-3,bottom,3,bottom+40) text(-2.6,bottom+38, paste(leg, "m")) todo2(who, bottom, loupe) } todo3(bottom = 110, who = z5, leg = 5) todo3(bottom = 50, who = z120, leg = 120) todo3(bottom = 5, who = z135, leg = 135) legend(-4.5,110,c('CpC','CpT','TpC','TpT'),lty=1,pt.cex=cex, col=c('blue','red','green','black')) mtext(expression(paste("Dinucleotide composition for three ", italic("Prochlorococcus marinus")," ecotypes")), outer = TRUE, cex = 2, line = 1) }# # Show the four YpY for the three ecotypes: # data(prochlo) oneplot <- function(x){ plot(density(prochlo$BX548174[, x]), ylim = c(0,0.4), xlim = c(-4,4), lty=3, main = paste(substr(x,1,1), "p", substr(x,2,2), " bias", sep = ""), xlab="",ylab="",las=1, type = "n") rect(-10,-1,-1.96,10, col = "yellow", border = "yellow") rect(1.96,-1,10,10, col = "yellow", border = "yellow") lines(density(prochlo$BX548174[, x]),lty=3) lines(density(prochlo$AE017126[, x]),lty=2) lines(density(prochlo$BX548175[, x]),lty=1) abline(v=c(-1.96,1.96),lty=5) box() } par(mfrow=c(2,2),mar=c(2,3,2,0.5) + 0.1) oneplot("CT") oneplot("TC") oneplot("CC") oneplot("TT") # # Show YpY biases with respect to light exposure # curdev <- getOption("device") OK <- FALSE devlist <- c("X11", "windows", "quartz") # interactive with width and height in inches for(i in devlist){ if(exists(i) && identical(get(i), curdev)){ OK <- TRUE break } } if(OK){ curdev(width = 18, height = 11) par(oma = c(0, 0, 3, 0), mfrow = c(1, 2), mar = c(5, 4, 0, 0), cex = 1.5) example(waterabs, ask = FALSE) #left figure par(mar = c(5, 0, 0, 2)) plot(seq(-5, 3, by = 1), seq(0, 150, length = 9), col = "white", ann = FALSE, axes = FALSE, xaxs = "i", yaxs = "i") axis(1, at = c(-1.96, 0, 1.96), labels = c(-1.96, 0, 1.96)) lines(rep(-1.96, 2),c(0, 150),lty=2) lines(rep(1.96, 2), c(0, 150),lty=2) title(xlab = "zscore distribution", cex = 1.5, adj = 0.65) selcol <- c(6, 8, 14, 16) z5 <- prochlo$BX548174[, selcol] z120 <- prochlo$AE017126[, selcol] z135 <- prochlo$BX548175[, selcol] todo <- function(who, xx, col = "black", bottom, loupe){ dst <- density(who[, xx]) sel <- which(dst$x >= -3) lines(dst$x[sel], dst$y[sel]*loupe + (bottom), col = col) } todo2 <- function(who, bottom, loupe){ todo(who, "CC", "blue", bottom, loupe) todo(who, "CT", "red", bottom, loupe) todo(who, "TC", "green", bottom, loupe) todo(who, "TT", "black", bottom, loupe) } todo3 <- function(bottom, who, leg, loupe = 90){ lines(c(-5,-3), c(150 - leg, bottom + 20)) rect(-3,bottom,3,bottom+40) text(-2.6,bottom+38, paste(leg, "m")) todo2(who, bottom, loupe) } todo3(bottom = 110, who = z5, leg = 5) todo3(bottom = 50, who = z120, leg = 120) todo3(bottom = 5, who = z135, leg = 135) legend(-4.5,110,c('CpC','CpT','TpC','TpT'),lty=1,pt.cex=cex, col=c('blue','red','green','black')) mtext(expression(paste("Dinucleotide composition for three ", italic("Prochlorococcus marinus")," ecotypes")), outer = TRUE, cex = 2, line = 1) }
This is a major command of the package. It executes all sequence retrievals using any selection criteria the data base allows. The sequences are coming from ACNUC data base located on the web and they are transfered by socket. The command produces the list of all sequence names that fit the required criteria. The sequence names belong to the class of sequence SeqAcnucWeb.
query(listname, query, socket = autosocket(), invisible = TRUE, verbose = FALSE, virtual = FALSE)query(listname, query, socket = autosocket(), invisible = TRUE, verbose = FALSE, virtual = FALSE)
listname |
The name of the list as a quoted string of chars |
query |
A quoted string of chars containing the request with the syntax given in the details section |
socket |
an object of class |
invisible |
if |
verbose |
if |
virtual |
if |
The query language defines several selection criteria and operations between
lists of elements matching criteria. It creates mainly lists of sequences, but
also lists of species (or, more generally, taxa) and of keywords.
See https://doua.prabi.fr/databases/acnuc/cfonctions.html#QUERYLANGUAGE
for the last update of the description of the query language.
Selection criteria (no space before the = sign) are:
seqs attached to taxon or any other below in tree; @ wildcard possible
seqs attached to given numerical NCBI's taxon id
seqs attached to keyword or any other below in tree; @ wildcard possible
seqs of specified type
seqs published in journal specified using defined journal code
seqs from reference specified such as in jcode/volume/page (e.g., JMB/13/5432)
seqs from references having specified author (only last name, no initial)
seqs attached to specified accession number
seqs of given name (ID or LOCUS); @ wildcard possible
seqs published in specified year; > and < can be used instead of =
seqs from specified organelle named following defined code (e.g., chloroplast)
seqs from specified molecule as named in ID or LOCUS annotation records
seqs from specified data class (EMBL) or review level (UniProt)
seqs whose names are in given file, one name per line (unimplemented use clfcd instead)
seqs attached to accession numbers in given file, one number per line (unimplemented use clfcd instead)
produces the list of keywords named in given file, one keyword per line (unimplemented use clfcd instead)
produces the list of species named in given file, one species per line (unimplemented use clfcd instead)
the named list that must have been previously constructed
Operators (always followed and preceded by blanks or parentheses) are:
intersection of the 2 list operands
union of the 2 list operands
complementation of the single list operand
compute the list of parent seqs of members of the single list operand
add subsequences of members of the single list operand
project to species: list of species attached to member sequences of the operand list
project to keywords: list of keywords attached to member sequences of the operand list
unproject: list of seqs attached to members of the species or keywords list operand
compute the list of species placed in the tree below the members of the species list operand
compute the list of keywords placed in the tree below the members of the keywords list operand
The query language is case insensitive.Three operators (AND, OR, NOT) can be ambiguous because they can also occur within valid criterion values. Such ambiguities can be solved by encapsulating elementary selection criteria between escaped double quotes.
The result is directly assigned to the object listname in the user workspace.
This is an objet of class qaw, a list with the following 6 components:
call |
the original call |
name |
the ACNUC list name |
nelem |
the number of elements (for instance sequences) in the ACNUC list |
typelist |
the type of the elements of the list. Could be SQ for a list of sequence names, KW for a list of keywords, SP for a list of species names. |
req |
a list of sequence names that fit the required criteria or |
socket |
the socket connection that was used |
Most of the documentation was imported from ACNUC help files written by Manolo Gouy
J.R. Lobry, D. Charif
Gouy, M., Milleret, F., Mugnier, C., Jacobzone, M., Gautier,C. (1984) ACNUC: a nucleic acid sequence data base and analysis system.
Nucl. Acids Res., 12:121-127.
Gouy, M., Gautier, C., Attimonelli, M., Lanave, C., Di Paola, G. (1985)
ACNUC - a portable retrieval system for nucleic acid sequence databases:
logical and physical designs and usage.
Comput. Appl. Biosci., 3:167-172.
Gouy, M., Gautier, C., Milleret, F. (1985) System analysis and nucleic acid sequence banks.
Biochimie, 67:433-436.
citation("seqinr")
choosebank,
getSequence,
getName,
crelistfromclientdata
## Not run: # Need internet connection choosebank("genbank") bb <- query("bb", "sp=Borrelia burgdorferi") # To get the names of the 4 first sequences: sapply(bb$req[1:4], getName) # To get the 4 first sequences: sapply(bb$req[1:4], getSequence, as.string = TRUE) ## End(Not run)## Not run: # Need internet connection choosebank("genbank") bb <- query("bb", "sp=Borrelia burgdorferi") # To get the names of the 4 first sequences: sapply(bb$req[1:4], getName) # To get the 4 first sequences: sapply(bb$req[1:4], getSequence, as.string = TRUE) ## End(Not run)
ABIF stands for Applied Biosystem Inc. Format, a binary fromat modeled after TIFF format.
Corresponding files usually have an *.ab1 or *.fsa extension.
read.abif(filename, max.bytes.in.file = file.info(filename)$size, pied.de.pilote = 1.2, verbose = FALSE)read.abif(filename, max.bytes.in.file = file.info(filename)$size, pied.de.pilote = 1.2, verbose = FALSE)
filename |
The name of the file. |
max.bytes.in.file |
The size in bytes of the file, defaulting to what is returned by |
pied.de.pilote |
Safety factor: the argument |
verbose |
logical [FALSE]. If TRUE verbose mode is on. |
All data are imported into memory, there is no attempt to read items on the fly.
A list with three components: Header which is a list that contains various low-level information,
among which numelements is the number of elements in the directory and dataoffset
the offset to find the location of the directory. Directory is a data.frame for the directory
of the file with the number of row being the number of elements in the directory and the 7
columns describing various low-level information about the elements. Data is a list
with the number of components equal to the number of elements in the directory.
J.R. Lobry
citation("seqinR")
Anonymous (2006) Applied Biosystem Genetic Analysis Data File Format. Available at https://www.thermofisher.com/de/de/home/brands/applied-biosystems.html. Last visited on 03-NOV-2008.
The figure in the example section is an attempt to reproduce figure 1A from:
Krawczyk, J., Goesmann, A., Nolte, R., Werber, M., Weisshaar, B. (2009) Trace2PS and FSA2PS: two software toolkits for converting trace and fsa files to PostScript format. Source Code for Biology and Medicine, 4:4.
readBin which is used here to import the binary file and file.info to
get the size of the file. See JLO for the files used in quality check.
# # Quality check: # data(JLO) JLO.check <- read.abif(system.file("abif/2_FAC321_0000205983_B02_004.fsa", package = "seqinr")) stopifnot(identical(JLO, JLO.check)) # # Try to reproduce figure 1A from Krawczyk et al. 2009: # Krawczyk <- read.abif(system.file("abif/samplefsa2ps.fsa", package = "seqinr"))$Data x <- 1:length(Krawczyk[["DATA.1"]]) par(mar = c(2,4,2,0)+0.1, cex = 0.5) plot(x, Krawczyk[["DATA.1"]], type = "l", col = "blue", ylab = "", xlab = "", ylim = c(-2000, 10000), cex = 0.5, main = "Figure 1A from Krawczyk et al. 2009", xaxs = "i", yaxs = "i", xaxt = "n", yaxt = "n") axis(1, at = seq(2000, 24000, by = 2000)) axis(2, at = seq(-1000, 10000, by = 1000), las = 1) lines(x, Krawczyk[["DATA.2"]], col = "green") lines(x, Krawczyk[["DATA.3"]], col = "black") lines(x, Krawczyk[["DATA.4"]], col = "red")# # Quality check: # data(JLO) JLO.check <- read.abif(system.file("abif/2_FAC321_0000205983_B02_004.fsa", package = "seqinr")) stopifnot(identical(JLO, JLO.check)) # # Try to reproduce figure 1A from Krawczyk et al. 2009: # Krawczyk <- read.abif(system.file("abif/samplefsa2ps.fsa", package = "seqinr"))$Data x <- 1:length(Krawczyk[["DATA.1"]]) par(mar = c(2,4,2,0)+0.1, cex = 0.5) plot(x, Krawczyk[["DATA.1"]], type = "l", col = "blue", ylab = "", xlab = "", ylim = c(-2000, 10000), cex = 0.5, main = "Figure 1A from Krawczyk et al. 2009", xaxs = "i", yaxs = "i", xaxt = "n", yaxt = "n") axis(1, at = seq(2000, 24000, by = 2000)) axis(2, at = seq(-1000, 10000, by = 1000), las = 1) lines(x, Krawczyk[["DATA.2"]], col = "green") lines(x, Krawczyk[["DATA.3"]], col = "black") lines(x, Krawczyk[["DATA.4"]], col = "red")
Read a file in mase, clustal, phylip, fasta or msf format.
These formats are used to store nucleotide or protein multiple alignments.
read.alignment(file, format, forceToLower = TRUE, seqtype = c("DNA", "AA"), oldclustal = FALSE, ...)read.alignment(file, format, forceToLower = TRUE, seqtype = c("DNA", "AA"), oldclustal = FALSE, ...)
file |
the name of the file which the aligned sequences are to be read from.
If it does not contain an absolute or relative path, the file name is relative
to the current working directory, |
format |
a character string specifying the format of the file : |
seqtype |
the nature of the sequence: |
forceToLower |
a logical defaulting to TRUE stating whether the returned characters in a DNA sequence should be in lower case (introduced in seqinR release 1.1-3). |
oldclustal |
a logical defaulting to FALSE wether to use the old C function to read a clustal file (which is faster but stricter concerning sequence line length.) |
... |
For the |
The mase format is used to store nucleotide or protein
multiple alignments. The beginning of the file must contain a header
containing at least one line (but the content of this header may be
empty). The header lines must begin by ;;. The body of the
file has the following structure: First, each entry must begin by
one (or more) commentary line. Commentary lines begin by the character
;. Again, this commentary line may be empty. After the
commentaries, the name of the sequence is written on a separate
line. At last, the sequence itself is written on the following lines.
The CLUSTAL format (*.aln) is the format of the ClustalW multialignment tool output. It can be described as follows. The word CLUSTAL is on the first line of the file. The alignment is displayed in blocks of a fixed length, each line in the block corresponding to one sequence. Each line of each block starts with the sequence name (maximum of 10 characters), followed by at least one space character. The sequence is then displayed in upper or lower cases, '-' denotes gaps. The residue number may be displayed at the end of the first line of each block.
MSF is the multiple sequence alignment format of the GCG sequence analysis package. It begins with the line (all uppercase) !!NA_MULTIPLE_ALIGNMENT 1.0 for nucleic acid sequences or !!AA_MULTIPLE_ALIGNMENT 1.0 for amino acid sequences. Do not edit or delete the file type if its present.(optional). A description line which contains informative text describing what is in the file. You can add this information to the top of the MSF file using a text editor.(optional) A dividing line which contains the number of bases or residues in the sequence, when the file was created, and importantly, two dots (..) which act as a divider between the descriptive information and the following sequence information.(required) msf files contain some other information: the Name/Weight, a Separating Line which must include two slashes (//) to divide the name/weight information from the sequence alignment.(required) and the multiple sequence alignment.
PHYLIP is a tree construction program. The format is as follows: the number of sequences and their length (in characters) is on the first line of the file. The alignment is displayed in an interleaved or sequential format. The sequence names are limited to 10 characters and may contain blanks.
Sequence in fasta format begins with a single-line description (distinguished by a greater-than (>) symbol), followed by sequence data on the next line.
An object of class alignment which is a list with the following components:
nb |
the number of aligned sequences |
nam |
a vector of strings containing the names of the aligned sequences |
seq |
a vector of strings containing the aligned sequences |
com |
a vector of strings containing the commentaries for each sequence or |
D. Charif, J.R. Lobry
citation("seqinr")
To read aligned sequences in NEXUS format, see the function
read.nexus that was available in the CompPairWise package
(not sure it is still maintained as of 09/09/09).
The NEXUS format was mainly used by the non-GPL commercial PAUP
software.
Related functions: as.matrix.alignment, read.fasta,
write.fasta, reverse.align, dist.alignment.
mase.res <- read.alignment(file = system.file("sequences/test.mase", package = "seqinr"), format = "mase") clustal.res <- read.alignment(file = system.file("sequences/test.aln", package = "seqinr"), format="clustal") phylip.res <- read.alignment(file = system.file("sequences/test.phylip", package = "seqinr"), format = "phylip") msf.res <- read.alignment(file = system.file("sequences/test.msf", package = "seqinr"), format = "msf") fasta.res <- read.alignment(file = system.file("sequences/Anouk.fasta", package = "seqinr"), format = "fasta") # # Quality control routine sanity checks: # data(mase); stopifnot(identical(mase, mase.res)) data(clustal); stopifnot(identical(clustal, clustal.res)) data(phylip); stopifnot(identical(phylip, phylip.res)) data(msf); stopifnot(identical(msf, msf.res)) data(fasta); stopifnot(identical(fasta, fasta.res)) # # Example of using extra arguments from the read.fasta function, here to keep # whole headers for sequences names. # whole.header.test <- read.alignment(file = system.file("sequences/LTPs128_SSU_aligned_First_Two.fasta", package = "seqinr"), format = "fasta", whole.header = TRUE) whole.header.test$nam # Sould be: # # [1] "D50541\t1\t1411\t1411bp\trna\tAbiotrophia defectiva\tAerococcaceae" # [2] "KP233895\t1\t1520\t1520bp\trna\tAbyssivirga alkaniphila\tLachnospiraceae" #mase.res <- read.alignment(file = system.file("sequences/test.mase", package = "seqinr"), format = "mase") clustal.res <- read.alignment(file = system.file("sequences/test.aln", package = "seqinr"), format="clustal") phylip.res <- read.alignment(file = system.file("sequences/test.phylip", package = "seqinr"), format = "phylip") msf.res <- read.alignment(file = system.file("sequences/test.msf", package = "seqinr"), format = "msf") fasta.res <- read.alignment(file = system.file("sequences/Anouk.fasta", package = "seqinr"), format = "fasta") # # Quality control routine sanity checks: # data(mase); stopifnot(identical(mase, mase.res)) data(clustal); stopifnot(identical(clustal, clustal.res)) data(phylip); stopifnot(identical(phylip, phylip.res)) data(msf); stopifnot(identical(msf, msf.res)) data(fasta); stopifnot(identical(fasta, fasta.res)) # # Example of using extra arguments from the read.fasta function, here to keep # whole headers for sequences names. # whole.header.test <- read.alignment(file = system.file("sequences/LTPs128_SSU_aligned_First_Two.fasta", package = "seqinr"), format = "fasta", whole.header = TRUE) whole.header.test$nam # Sould be: # # [1] "D50541\t1\t1411\t1411bp\trna\tAbiotrophia defectiva\tAerococcaceae" # [2] "KP233895\t1\t1520\t1520bp\trna\tAbyssivirga alkaniphila\tLachnospiraceae" #
Read nucleic or amino-acid sequences from a file in FASTA format.
read.fasta(file = system.file("sequences/ct.fasta.gz", package = "seqinr"), seqtype = c("DNA", "AA"), as.string = FALSE, forceDNAtolower = TRUE, set.attributes = TRUE, legacy.mode = TRUE, seqonly = FALSE, strip.desc = FALSE, whole.header = FALSE, bfa = FALSE, sizeof.longlong = .Machine$sizeof.longlong, endian = .Platform$endian, apply.mask = TRUE)read.fasta(file = system.file("sequences/ct.fasta.gz", package = "seqinr"), seqtype = c("DNA", "AA"), as.string = FALSE, forceDNAtolower = TRUE, set.attributes = TRUE, legacy.mode = TRUE, seqonly = FALSE, strip.desc = FALSE, whole.header = FALSE, bfa = FALSE, sizeof.longlong = .Machine$sizeof.longlong, endian = .Platform$endian, apply.mask = TRUE)
file |
The name of the file which the sequences in fasta format are to be
read from. If it does not contain an absolute or relative path, the file name is relative
to the current working directory, |
seqtype |
the nature of the sequence: |
as.string |
if TRUE sequences are returned as a string instead of a vector of single characters |
forceDNAtolower |
whether sequences with |
set.attributes |
whether sequence attributes should be set |
legacy.mode |
if TRUE lines starting with a semicolon ';' are ignored |
seqonly |
if TRUE, only sequences as returned without attempt to modify them or to get their names and annotations (execution time is divided approximately by a factor 3) |
strip.desc |
if TRUE the '>' at the beginning of the description lines is removed in the annotations of the sequences |
whole.header |
if TRUE the whole header line, except the first '>' character, is kept for sequence name. If FALSE, the default, the name is truncated at the first space (" ") character. |
bfa |
logical. If TRUE the fasta file is in MAQ binary format (see details). Only for DNA sequences. |
sizeof.longlong |
the number of bytes in a C |
endian |
character string, |
apply.mask |
logical defaulting to |
FASTA is a widely used format in biology, some FASTA files are distributed with the seqinr package, see the examples section below. Sequence in FASTA format begins with a single-line description (distinguished by a greater-than '>' symbol), followed by sequence data on the next lines. Lines starting by a semicolon ';' are ignored, as in the original FASTA program (Pearson and Lipman 1988). The sequence name is just after the '>' up to the next space ' ' character, trailling infos are ignored for the name but saved in the annotations.
There is no standard file extension name for a FASTA file. Commonly found values are .fasta, .fas, .fa and .seq for generic FASTA files. More specific file extension names are also used for fasta sequence alignement (.fsa), fasta nucleic acid (.fna), fasta functional nucleotide (.ffn), fasta amino acid (.faa), multiple protein fasta (.mpfa), fasta RNA non-coding (.frn).
The MAQ fasta binary format was introduced in seqinR 1.1-7 and has not
been extensively tested. This format is used in the MAQ (Mapping and
Assembly with Qualities) software (https://maq.sourceforge.net/).
In this format the four nucleotides are coded with two bits and the
sequence is stored as a vector of C unsigned long long. There
is in addition a mask to locate non-acgt characters.
By default read.fasta return a list of vector of chars. Each element
is a sequence object of the class SeqFastadna or SeqFastaAA.
The old argument File that was deprecated since seqinR >= 1.1-3 is
no more valid since seqinR >= 2.0-6. Just use file instead.
D. Charif, J.R. Lobry
Pearson, W.R. and Lipman, D.J. (1988) Improved tools for biological sequence comparison. Proceedings of the National Academy of Sciences of the United States of America, 85:2444-2448
According to MAQ's FAQ page https://maq.sourceforge.net/faq.shtml last consulted 2016-06-07 the MAQ manuscript has not been published.
citation("seqinr")
write.fasta to write sequences in a FASTA file,
gb2fasta to convert a GenBank file into a FASTA file,
read.alignment to read aligned sequences,
reverse.align to get an alignment at the nucleic level from the
one at the amino-acid level
# # Simple sanity check with a small FASTA file: # smallFastaFile <- system.file("sequences/smallAA.fasta", package = "seqinr") mySmallProtein <- read.fasta(file = smallFastaFile, as.string = TRUE, seqtype = "AA")[[1]] stopifnot(mySmallProtein == "SEQINRSEQINRSEQINRSEQINR*") # # Simple sanity check with the gzipped version of the same small FASTA file: # smallFastaFile <- system.file("sequences/smallAA.fasta.gz", package = "seqinr") mySmallProtein <- read.fasta(file = smallFastaFile, as.string = TRUE, seqtype = "AA")[[1]] stopifnot(mySmallProtein == "SEQINRSEQINRSEQINRSEQINR*") # # Example of a DNA file in FASTA format: # dnafile <- system.file("sequences/malM.fasta", package = "seqinr") # # Read with defaults arguments, looks like: # # $XYLEECOM.MALM # [1] "a" "t" "g" "a" "a" "a" "a" "t" "g" "a" "a" "t" "a" "a" "a" "a" "g" "t" # ... read.fasta(file = dnafile) # # The same but do not turn the sequence into a vector of single characters, looks like: # # $XYLEECOM.MALM # [1] "atgaaaatgaataaaagtctcatcgtcctctgtttatcagcagggttactggcaagcgc # ... read.fasta(file = dnafile, as.string = TRUE) # # The same but do not force lower case letters, looks like: # # $XYLEECOM.MALM # [1] "ATGAAAATGAATAAAAGTCTCATCGTCCTCTGTTTATCAGCAGGGTTACTGGCAAGC # ... read.fasta(file = dnafile, as.string = TRUE, forceDNAtolower = FALSE) # # Example of a protein file in FASTA format: # aafile <- system.file("sequences/seqAA.fasta", package = "seqinr") # # Read the protein sequence file, looks like: # # $A06852 # [1] "M" "P" "R" "L" "F" "S" "Y" "L" "L" "G" "V" "W" "L" "L" "L" "S" "Q" "L" # ... read.fasta(aafile, seqtype = "AA") # # The same, but as string and without attributes, looks like: # # $A06852 # [1] "MPRLFSYLLGVWLLLSQLPREIPGQSTNDFIKACGRELVRLWVEICGSVSWGRTALSLEEP # QLETGPPAETMPSSITKDAEILKMMLEFVPNLPQELKATLSERQPSLRELQQSASKDSNLNFEEFK # KIILNRQNEAEDKSLLELKNLGLDKHSRKKRLFRMTLSEKCCQVGCIRKDIARLC*" # read.fasta(aafile, seqtype = "AA", as.string = TRUE, set.attributes = FALSE) # # Example with a FASTA file that contains comment lines starting with # a semicolon character ';' # legacyfile <- system.file("sequences/legacy.fasta", package = "seqinr") legacyseq <- read.fasta(file = legacyfile, as.string = TRUE) stopifnot( nchar(legacyseq) == 921 ) # # Example of a MAQ binary fasta file produced with maq fasta2bfa ct.fasta ct.bfa # on a platform where .Platform$endian == "little" and .Machine$sizeof.longlong == 8 # fastafile <- system.file("sequences/ct.fasta.gz", package = "seqinr") bfafile <- system.file("sequences/ct.bfa", package = "seqinr") original <- read.fasta(fastafile, as.string = TRUE, set.att = FALSE) bfavers <- read.fasta(bfafile, as.string = TRUE, set.att = FALSE, bfa = TRUE, endian = "little", sizeof.longlong = 8) if(!identical(original, bfavers)){ warning(paste("trouble reading bfa file on a platform with endian =", .Platform$endian, "and sizeof.longlong =", .Machine$sizeof.longlong)) }# # Simple sanity check with a small FASTA file: # smallFastaFile <- system.file("sequences/smallAA.fasta", package = "seqinr") mySmallProtein <- read.fasta(file = smallFastaFile, as.string = TRUE, seqtype = "AA")[[1]] stopifnot(mySmallProtein == "SEQINRSEQINRSEQINRSEQINR*") # # Simple sanity check with the gzipped version of the same small FASTA file: # smallFastaFile <- system.file("sequences/smallAA.fasta.gz", package = "seqinr") mySmallProtein <- read.fasta(file = smallFastaFile, as.string = TRUE, seqtype = "AA")[[1]] stopifnot(mySmallProtein == "SEQINRSEQINRSEQINRSEQINR*") # # Example of a DNA file in FASTA format: # dnafile <- system.file("sequences/malM.fasta", package = "seqinr") # # Read with defaults arguments, looks like: # # $XYLEECOM.MALM # [1] "a" "t" "g" "a" "a" "a" "a" "t" "g" "a" "a" "t" "a" "a" "a" "a" "g" "t" # ... read.fasta(file = dnafile) # # The same but do not turn the sequence into a vector of single characters, looks like: # # $XYLEECOM.MALM # [1] "atgaaaatgaataaaagtctcatcgtcctctgtttatcagcagggttactggcaagcgc # ... read.fasta(file = dnafile, as.string = TRUE) # # The same but do not force lower case letters, looks like: # # $XYLEECOM.MALM # [1] "ATGAAAATGAATAAAAGTCTCATCGTCCTCTGTTTATCAGCAGGGTTACTGGCAAGC # ... read.fasta(file = dnafile, as.string = TRUE, forceDNAtolower = FALSE) # # Example of a protein file in FASTA format: # aafile <- system.file("sequences/seqAA.fasta", package = "seqinr") # # Read the protein sequence file, looks like: # # $A06852 # [1] "M" "P" "R" "L" "F" "S" "Y" "L" "L" "G" "V" "W" "L" "L" "L" "S" "Q" "L" # ... read.fasta(aafile, seqtype = "AA") # # The same, but as string and without attributes, looks like: # # $A06852 # [1] "MPRLFSYLLGVWLLLSQLPREIPGQSTNDFIKACGRELVRLWVEICGSVSWGRTALSLEEP # QLETGPPAETMPSSITKDAEILKMMLEFVPNLPQELKATLSERQPSLRELQQSASKDSNLNFEEFK # KIILNRQNEAEDKSLLELKNLGLDKHSRKKRLFRMTLSEKCCQVGCIRKDIARLC*" # read.fasta(aafile, seqtype = "AA", as.string = TRUE, set.attributes = FALSE) # # Example with a FASTA file that contains comment lines starting with # a semicolon character ';' # legacyfile <- system.file("sequences/legacy.fasta", package = "seqinr") legacyseq <- read.fasta(file = legacyfile, as.string = TRUE) stopifnot( nchar(legacyseq) == 921 ) # # Example of a MAQ binary fasta file produced with maq fasta2bfa ct.fasta ct.bfa # on a platform where .Platform$endian == "little" and .Machine$sizeof.longlong == 8 # fastafile <- system.file("sequences/ct.fasta.gz", package = "seqinr") bfafile <- system.file("sequences/ct.bfa", package = "seqinr") original <- read.fasta(fastafile, as.string = TRUE, set.att = FALSE) bfavers <- read.fasta(bfafile, as.string = TRUE, set.att = FALSE, bfa = TRUE, endian = "little", sizeof.longlong = 8) if(!identical(original, bfavers)){ warning(paste("trouble reading bfa file on a platform with endian =", .Platform$endian, "and sizeof.longlong =", .Machine$sizeof.longlong)) }
In a Bins configuration file there is a description for a given identification kit of the expected allele sizes for all the markers available in the kit.
readBins(file, colnames = c("allele.name", "size.bp", "minus.bp", "plus.bp"))readBins(file, colnames = c("allele.name", "size.bp", "minus.bp", "plus.bp"))
file |
The name of the Bins configuration file. |
colnames |
The names to be used for the columns of the data.frames. |
The expected allele sizes are typically plus or minus 0.5 bp.
A list whose first element is the file header info and following elements are lists, one for each kit encountered in the file. For each kit we have a list of data.frames, one per marker.
J.R. Lobry
citation("seqinR")
# # Check that we can read the 2 exemple files in the seqinR package: # path1 <- system.file("abif/AmpFLSTR_Bins_v1.txt", package = "seqinr") resbin1 <- readBins(path1) path2 <- system.file("abif/Promega_Bins_v1.txt", package = "seqinr") resbin2 <- readBins(path2) # # Show the kits described in resbin1: # names(resbin1) # # Show the markers in a given kit: # names(resbin1[["Identifiler_v1"]]) # # Show alleles expected sizes for a given marker: # resbin1[["Identifiler_v1"]][["D8S1179"]] # # Simple quality check since seqinr 2.0-4 with a configuration file # containing trailling tabulations: # path3 <- system.file("abif/Prototype_PowerPlex_EP01_Bins.txt", package = "seqinr") resbin3 <- readBins(path3) ncols <- sapply(resbin3[[2]], ncol) stopifnot(all(ncols == 4))# # Check that we can read the 2 exemple files in the seqinR package: # path1 <- system.file("abif/AmpFLSTR_Bins_v1.txt", package = "seqinr") resbin1 <- readBins(path1) path2 <- system.file("abif/Promega_Bins_v1.txt", package = "seqinr") resbin2 <- readBins(path2) # # Show the kits described in resbin1: # names(resbin1) # # Show the markers in a given kit: # names(resbin1[["Identifiler_v1"]]) # # Show alleles expected sizes for a given marker: # resbin1[["Identifiler_v1"]][["D8S1179"]] # # Simple quality check since seqinr 2.0-4 with a configuration file # containing trailling tabulations: # path3 <- system.file("abif/Prototype_PowerPlex_EP01_Bins.txt", package = "seqinr") resbin3 <- readBins(path3) ncols <- sapply(resbin3[[2]], ncol) stopifnot(all(ncols == 4))
Called without arguments, the list of available values for argument type is returned.
readfirstrec(socket = autosocket(), type)readfirstrec(socket = autosocket(), type)
socket |
an object of class |
type |
the ACNUC index file |
Available index files are:
AUTHOR one record for each author name (last name only, no initials)
BIBLIO one record for each reference
ACCESS one record for each accession number
SMJYT one record for each status, molecule, journal, year, type, organelle, division, and db structure information
SUBSEQ one record for each parent or sub-sequence
LOCUS one record for each parent sequence
KEYWORDS one record for each keyword
SPECIES one record for each taxon
SHORTL mostly, one record for each element of a short list
LONGL one record for each group of SUBINLNG elements of a long list
EXTRACT (for nucleotide databases only) one record for each exon of each subsequence
TEXT one lrtxt-character record for each label of a species, keyword, or SMJYT
The record count of ACNUC index file, or NA if missing (typically when asking for type = EXT on a protein database).
J.R. Lobry
See ACNUC physical structure at
https://doua.prabi.fr/databases/acnuc/structure.html.
citation("seqinr")
## Not run: # Need internet connection choosebank("genbank") allowedtype <- readfirstrec() sapply(allowedtype, function(x) readfirstrec(type = x)) ## End(Not run)## Not run: # Need internet connection choosebank("genbank") allowedtype <- readfirstrec() sapply(allowedtype, function(x) readfirstrec(type = x)) ## End(Not run)
In a Panel configuration file there is a description for a given identification kit of the marker names, their dye label color, expected size range, expected positive control genotypes, number of bases in core repeat, stutter percentages, and allele names.
readPanels(file, colnames = c("marker", "dye.col", "min.bp", "max.bp", "exp.pcg", "repeat.bp", "stutter.pc", "uknw", "allele names"))readPanels(file, colnames = c("marker", "dye.col", "min.bp", "max.bp", "exp.pcg", "repeat.bp", "stutter.pc", "uknw", "allele names"))
file |
The name of the Panel configuration file. |
colnames |
The names to be used for the columns of the data.frames. |
Number of bases in core repeat is set to 9 for Amelogenin locus.
A list whose first element is the file header info and following elements data.frames, one for each kit encountered in the file.
J.R. Lobry
citation("seqinR")
# # Check that we can read the 2 exemple files in the seqinR package: # path1 <- system.file("abif/AmpFLSTR_Panels_v1.txt", package = "seqinr") res1 <- readPanels(path1) path2 <- system.file("abif/Promega_Panels_v1.txt", package = "seqinr") res2 <- readPanels(path2) # # Show the kits described in res1: # names(res1) # # Show some data for a given kit: # res1[["Identifiler_v1"]][, 1:7] # # Plot a simple summary of two kits: # par(mfrow = c(2,1)) plotPanels("Identifiler_v1", res1) plotPanels("PowerPlex_16_v1", res2) # # Simple quality check since seqinR 2.0-4 with a file which containing # a non constant number of tabulations as separator: # path3 <- system.file("abif/Prototype_PowerPlex_EP01_Pa.txt", package = "seqinr") res3 <- readPanels(path3)# # Check that we can read the 2 exemple files in the seqinR package: # path1 <- system.file("abif/AmpFLSTR_Panels_v1.txt", package = "seqinr") res1 <- readPanels(path1) path2 <- system.file("abif/Promega_Panels_v1.txt", package = "seqinr") res2 <- readPanels(path2) # # Show the kits described in res1: # names(res1) # # Show some data for a given kit: # res1[["Identifiler_v1"]][, 1:7] # # Plot a simple summary of two kits: # par(mfrow = c(2,1)) plotPanels("Identifiler_v1", res1) plotPanels("PowerPlex_16_v1", res2) # # Simple quality check since seqinR 2.0-4 with a file which containing # a non constant number of tabulations as separator: # path3 <- system.file("abif/Prototype_PowerPlex_EP01_Pa.txt", package = "seqinr") res3 <- readPanels(path3)
Extract informations from the SMJYT index file for status, molecule, journal, year, type, organelle, division, and db structure information.
readsmj(socket = autosocket(), num = 2, nl = 10, recnum.add = FALSE, nature.add = TRUE, plong.add = FALSE, libel.add = FALSE, sname.add = FALSE, all.add = FALSE)readsmj(socket = autosocket(), num = 2, nl = 10, recnum.add = FALSE, nature.add = TRUE, plong.add = FALSE, libel.add = FALSE, sname.add = FALSE, all.add = FALSE)
socket |
an object of class |
num |
rank number of first record. |
nl |
number of records to read. |
recnum.add |
to extract record numbers. |
nature.add |
to extract as a factor with human understandable levels the nature of the name. Unordered levels are: status, molecule, journal, year, type, organelle, division and dbstrucinfo. |
plong.add |
to extract the plong. |
libel.add |
to extract the label of the name. |
sname.add |
to extract the short version of the name, that is without the first two characters. |
all.add |
to extract all (all flags set to TRUE). |
A data.frame with requested columns.
J.R. Lobry
See ACNUC physical structure at:
https://doua.prabi.fr/databases/acnuc/structure.html.
citation("seqinr")
choosebank to start a session and
readfirstrec to get the total number of records.
Detection of replication-associated effects on base composition asymmetry in prokaryotic chromosomes.
rearranged.oriloc(seq.fasta = system.file("sequences/ct.fasta.gz", package = "seqinr"), g2.coord = system.file("sequences/ct.predict", package = "seqinr"))rearranged.oriloc(seq.fasta = system.file("sequences/ct.fasta.gz", package = "seqinr"), g2.coord = system.file("sequences/ct.predict", package = "seqinr"))
seq.fasta |
The path of the file containing a FASTA-format sequence. Default value: the FASTA sequence of the Chlamydia trachomatis chromosome. |
g2.coord |
The path of the file containing the coordinates of the
protein coding genes found on this chromosome. This file can be
obtained using the function |
The purpose of this method is to decouple replication-related
and coding sequence-related effects on base composition asymmetry. In
order to do so, the analyzed chromosome is artificially rearranged to
obtain a perfect gene orientation bias - all forward transcribed genes
on the first half of the chromosome, and all reverse transcribed genes
on the other half.
This rearrangement conserves the relative order of genes within each of
the two groups - both forward-encoded and reverse-encoded genes are
placed on the rearranged chromosome in increasing order of their
coordinates on the real chromosome.
If the replication mechanism has a significant effect on base
composition asymmetry, this should be seen as a change of slope in the
nucleotide skews computed on the rearranged chromosome; the change of
slope should take place at the origin or the terminus of replication.
Use extract.breakpoints to detect the position of the changes in
slope on the rearranged nucleotide skews.
A data.frame with six columns: meancoord.rearr contains the
gene index on the rearranged chromosome; gcskew.rearr contains
the normalized GC-skew ((G-C)/(G+C)) computed on the third codon positions of
protein coding genes, still on the rearranged chromosome; atskew.rearr contains
the normalized AT-skew ((A-T)/(A+T)) computed on the third codon positions of
protein coding genes; strand.rearr contains the transcription
strand of the gene (either "forward" or "reverse"); order
contains the permutation that was used to obtain a perfect gene
orientation bias; meancoord.real contains the mid-coordinate of
the genes on the real chromosome (before the rearrangement).
A. Necşulea
Necşulea, A. and Lobry, J.R. (2007) A New Method for Assessing the Effect of Replication on DNA Base Composition Asymmetry. Molecular Biology and Evolution, 24:2169-2179.
oriloc, draw.rearranged.oriloc,
extract.breakpoints
### Example for Chlamydia trachomatis #### ### Rearrange the chromosome and compute the nucleotide skews ### ## Not run: r.ori <- rearranged.oriloc(seq.fasta = system.file("sequences/ct.fasta.gz", package = "seqinr"), g2.coord = system.file("sequences/ct.predict", package = "seqinr")) ## End(Not run) ### Extract the breakpoints for the rearranged nucleotide skews ### ## Not run: breaks <- extract.breakpoints(r.ori, type = c("gcfw", "gcrev"), nbreaks =c(2, 2), gridsize = 50, it.max = 100) ## End(Not run) ### Draw the rearranged nucleotide skews and place the position of the breakpoints ### ### on the graphics ### ## Not run: draw.rearranged.oriloc(r.ori, breaks.gcfw = breaks$gcfw$breaks, breaks.gcrev = breaks$gcrev$breaks) ## End(Not run)### Example for Chlamydia trachomatis #### ### Rearrange the chromosome and compute the nucleotide skews ### ## Not run: r.ori <- rearranged.oriloc(seq.fasta = system.file("sequences/ct.fasta.gz", package = "seqinr"), g2.coord = system.file("sequences/ct.predict", package = "seqinr")) ## End(Not run) ### Extract the breakpoints for the rearranged nucleotide skews ### ## Not run: breaks <- extract.breakpoints(r.ori, type = c("gcfw", "gcrev"), nbreaks =c(2, 2), gridsize = 50, it.max = 100) ## End(Not run) ### Draw the rearranged nucleotide skews and place the position of the breakpoints ### ### on the graphics ### ## Not run: draw.rearranged.oriloc(r.ori, breaks.gcfw = breaks$gcfw$breaks, breaks.gcrev = breaks$gcrev$breaks) ## End(Not run)
This function aims at predicting the position of Coding DNA Sequences (CDS) through the use of a Correspondence Analysis (CA) computed on codon composition, this for the three reading frames of a DNA strand.
recstat(seq, sizewin = 90, shift = 30, seqname = "no name")recstat(seq, sizewin = 90, shift = 30, seqname = "no name")
seq |
a nucleic acid sequence as a vector of characters |
sizewin |
an integer, multiple of 3, giving the length of the sliding window |
shift |
an integer, multiple of 3, giving the length of the steps between two windows |
seqname |
the name of the sequence |
The method is built on the hypothesis that the codon composition of a CDS is biased while it is not the case outside these regions. In order to detect such bias, a CA on codon frequencies is computed on the six possible reading frames of a DNA sequence (three from the direct strand and three from the reverse strand). When there is a CDS in one of the reading frame, it is expected that the CA factor scores observed in this frame (fot both rows and columns) will be significantly different from those in the two others.
This function returns a list containing the following components:
seq |
a single DNA sequence as a vector of characters |
sizewin |
length of the sliding window |
shift |
length of the steps between windows |
seqsize |
length of the sequence |
seqname |
name of the sequence |
vdep |
a vector containing the positions of windows starts |
vind |
a vector containing the reading frame of each window |
vstopd |
a vector of stop codons positions in direct strand |
vstopr |
a vector of stop codons positions in reverse strand |
vinitd |
a vector of start codons positions in direct strand |
vinitr |
a vector of start codons positions in reverse strand |
resd |
a matrix containing codons frequencies for all the windows in the three frames of the direct strand |
resr |
a matrix containing codons frequencies for all the windows in the three frames of the reverse strand |
resd.coa |
list of class |
resr.coa |
list of class |
This method works only with DNA sequences long enough to obtain a sufficient number of windows. As the optimal windows length has been estimated to be 90 bp by Fichant and Gautier (1987), the minimal sequence length is around 500 bp. The method can be used on prokaryotic and eukaryotic sequences. Also, only the four first factors of the CA are kept. Indeed, most of the time, only the first factor is relevant in order to detect CDS.
O. Clerc, G. Perrière
The original paper describing recstat is:
Fichant, G., Gautier, C. (1987) Statistical method for predicting protein coding
regions in nucleic acid sequences. Comput. Appl. Biosci., 3, 287–295.
doi:10.1093/bioinformatics/3.4.287
draw.recstat, test.li.recstat, test.co.recstat
ff <- system.file("sequences/ECOUNC.fsa", package = "seqinr") seq <- read.fasta(ff) rec <- recstat(seq[[1]], seqname = getName(seq))ff <- system.file("sequences/ECOUNC.fsa", package = "seqinr") seq <- read.fasta(ff) rec <- recstat(seq[[1]], seqname = getName(seq))
Computes the total number of residues (nucleotides or aminoacids) in all sequences of the list of specified rank.
residuecount(lrank, socket = autosocket())residuecount(lrank, socket = autosocket())
lrank |
the list rank on the ACNUC server |
socket |
an object of class |
A single numeric value corresponding to the total number of residues or NA in case of problem.
J.R. Lobry
https://doua.prabi.fr/databases/acnuc.html
citation("seqinr")
## Not run: ### Need internet connection choosebank("emblTP") mylist <- query("mylist", "t=CDS", virtual = TRUE) stopifnot(residuecount(glr("mylist")) == 1611439240) stopifnot(is.na(residuecount(glr("unknowlist")))) # A warning is issued ## End(Not run)## Not run: ### Need internet connection choosebank("emblTP") mylist <- query("mylist", "t=CDS", virtual = TRUE) stopifnot(residuecount(glr("mylist")) == 1611439240) stopifnot(is.na(residuecount(glr("unknowlist")))) # A warning is issued ## End(Not run)
This dataset is used as a sanity check in reverse.align.
data(revaligntest)data(revaligntest)
An object of class alignment with 3 sequences.
citation("seqinr")
data(revaligntest)data(revaligntest)
This function produces an alignment of nucleic protein-coding sequences, using as a guide the alignment of the corresponding protein sequences.
reverse.align(nucl.file, protaln.file, input.format = 'fasta', out.file, output.format = 'fasta', align.prot = FALSE, numcode = 1, clustal.path = NULL, forceDNAtolower = TRUE, forceAAtolower = FALSE)reverse.align(nucl.file, protaln.file, input.format = 'fasta', out.file, output.format = 'fasta', align.prot = FALSE, numcode = 1, clustal.path = NULL, forceDNAtolower = TRUE, forceAAtolower = FALSE)
nucl.file |
A character string specifying the name of the FASTA format file containing the nucleotide sequences. |
protaln.file |
A character string specifying the name of the file containing the aligned
protein sequences. This argument must be provided if |
input.format |
A character string specifying the format of the protein alignment file : 'mase', 'clustal', 'phylip', 'fasta' or 'msf'. |
out.file |
A character string specifying the name of the output file. |
output.format |
A character string specifying the format of the output file. Currently the only implemented format is 'fasta'. |
align.prot |
Boolean. If TRUE, the nucleic sequences are
translated and then the protein sequences are aligned with the ClustalW program. The path
of the ClustalW binary must also be given ( |
numcode |
The NCBI genetic code number for the translation of the nucleic sequences. By default the standard genetic code is used. |
clustal.path |
The path of the ClustalW binary. This argument
only needs to be setif |
forceDNAtolower |
logical passed to |
forceAAtolower |
logical passed to |
This function an alignment of nucleic protein-coding sequences using as a guide the alignment of the corresponding protein sequences. The file containing the nucleic sequences is given in the compulsory argument 'nucl.file'; this file must be written in the FASTA format.
The alignment of the protein sequences can either be provided directly, trough the 'protaln.file' parameter, or reconstructed with ClustalW, if the parameter 'align.prot' is set to TRUE. In the latter case, the pathway of the ClustalW binary must be given in the 'clustal.path' argument.
The protein and nucleic sequences must have the same name in the files
nucl.file and protaln.file.
The reverse-aligned nucleotide sequences are written to the file specified in the compulsory 'out.file' argument. For now, the only output format implemented is FASTA.
Warning: the 'align.prot=TRUE' option has only been tested on LINUX operating systems. ClustalW must be installed on your system in order for this to work.
NULL
A. Necşulea
citation('seqinr')
read.alignment, read.fasta, write.fasta
# # Read example 'bordetella.fasta': a triplet of orthologous genes from # three bacterial species (Bordetella pertussis, B. parapertussis and # B. bronchiseptica): # nucl.file <- system.file('sequences/bordetella.fasta', package = 'seqinr') triplet <- read.fasta(nucl.file) # # For this example, 'bordetella.pep.aln' contains the aligned protein # sequences, in the Clustal format: # protaln.file <- system.file('sequences/bordetella.pep.aln', package = 'seqinr') triplet.pep<- read.alignment(protaln.file, format = 'clustal') # # Call reverse.align for this example: # myOutFileName <-tempfile(pattern = "test", tmpdir = tempdir(), fileext = "revalign") tempdir(check = FALSE) #reverse.align(nucl.file = nucl.file, protaln.file = protaln.file, # input.format = 'clustal', out.file = 'test.revalign') reverse.align(nucl.file = nucl.file, protaln.file = protaln.file, input.format = 'clustal', out.file = myOutFileName) # # Simple sanity check against expected result: # #res.new <- read.alignment("test.revalign", format = "fasta") res.new <- read.alignment(myOutFileName, format = "fasta") data(revaligntest) stopifnot(identical(res.new, revaligntest)) # # Alternatively, we can use ClustalW to align the translated nucleic # sequences. Here the ClustalW program is accessible simply by the # 'clustalw' name. # ## Not run: reverse.align(nucl.file = nucl.file, out.file = 'test.revalign.clustal', align.prot = TRUE, clustal.path = 'clustalw') ## End(Not run)# # Read example 'bordetella.fasta': a triplet of orthologous genes from # three bacterial species (Bordetella pertussis, B. parapertussis and # B. bronchiseptica): # nucl.file <- system.file('sequences/bordetella.fasta', package = 'seqinr') triplet <- read.fasta(nucl.file) # # For this example, 'bordetella.pep.aln' contains the aligned protein # sequences, in the Clustal format: # protaln.file <- system.file('sequences/bordetella.pep.aln', package = 'seqinr') triplet.pep<- read.alignment(protaln.file, format = 'clustal') # # Call reverse.align for this example: # myOutFileName <-tempfile(pattern = "test", tmpdir = tempdir(), fileext = "revalign") tempdir(check = FALSE) #reverse.align(nucl.file = nucl.file, protaln.file = protaln.file, # input.format = 'clustal', out.file = 'test.revalign') reverse.align(nucl.file = nucl.file, protaln.file = protaln.file, input.format = 'clustal', out.file = myOutFileName) # # Simple sanity check against expected result: # #res.new <- read.alignment("test.revalign", format = "fasta") res.new <- read.alignment(myOutFileName, format = "fasta") data(revaligntest) stopifnot(identical(res.new, revaligntest)) # # Alternatively, we can use ClustalW to align the translated nucleic # sequences. Here the ClustalW program is accessible simply by the # 'clustalw' name. # ## Not run: reverse.align(nucl.file = nucl.file, out.file = 'test.revalign.clustal', align.prot = TRUE, clustal.path = 'clustalw') ## End(Not run)
rot13 applied to the above title returns the string "Returns the ROT-13 ciphering of a string".
rot13(string)rot13(string)
string |
a string of characters. |
a string of characters.
J.R. Lobry
citation("seqinr")
## ## Simple ciphering of a string: ## message <- "Hello, world!" rot13(message) # "Uryyb, jbeyq!" ## ## Routine sanity check: ## stopifnot(identical(rot13(rot13(message)), message))## ## Simple ciphering of a string: ## message <- "Hello, world!" rot13(message) # "Uryyb, jbeyq!" ## ## Routine sanity check: ## stopifnot(identical(rot13(rot13(message)), message))
This is a simple utility function to convert a single string such
as "BigBang" into a vector of chars such as
c("B", "i", "g", "B", "a", "n", "g").
s2c(string)s2c(string)
string |
a string of chars |
a vector of chars. If supplied argument is not a single string, a warning is issued and NA returned.
J.R. Lobry
citation("seqinr")
stopifnot(all(s2c("BigBang") == c("B", "i", "g", "B", "a", "n", "g")))stopifnot(all(s2c("BigBang") == c("B", "i", "g", "B", "a", "n", "g")))
By default, if no levels arguments is provided, this function will
just code your DNA sequence in integer values following the lexical
order (a > c > g > t), that is 0 for "a", 1 for "c", 2 for "g", 3 for
"t" and NA for ambiguous bases.
s2n(seq, levels = s2c("acgt"), base4 = TRUE, forceToLower = TRUE)s2n(seq, levels = s2c("acgt"), base4 = TRUE, forceToLower = TRUE)
seq |
the sequence as a vector of single chars |
levels |
allowed char values, by default a, c, g and t |
base4 |
if TRUE the numerical encoding will start at O, if FALSE at 1 |
forceToLower |
if TRUE the sequence is forced to lower case caracters |
a vector of integers
The idea of starting numbering at 0 by default is that it enforces a kind of isomorphism between the paste operator on DNA chars and the + operator on integer coding for DNA chars. By this way, you can work either in the char set, either in the integer set, depending on what is more convenient for your purpose, and then switch from one set to the other one as you like.
J.R. Lobry
citation("seqinr")
## ## Example of default behaviour: ## urndna <- s2c("acgt") seq <- sample( urndna, 100, replace = TRUE ) ; seq s2n(seq) ## ## How to deal with RNA: ## urnrna <- s2c("acgt") seq <- sample( urnrna, 100, replace = TRUE ) ; seq s2n(seq) ## ## what happens with unknown characters: ## urnmess <- c(urndna,"n") seq <- sample( urnmess, 100, replace = TRUE ) ; seq s2n(seq) ## ## How to change the encoding for unknown characters: ## tmp <- s2n(seq) ; tmp[is.na(tmp)] <- -1; tmp ## ## Simple sanity check: ## stopifnot(all(s2n(s2c("acgt")) == 0:3))## ## Example of default behaviour: ## urndna <- s2c("acgt") seq <- sample( urndna, 100, replace = TRUE ) ; seq s2n(seq) ## ## How to deal with RNA: ## urnrna <- s2c("acgt") seq <- sample( urnrna, 100, replace = TRUE ) ; seq s2n(seq) ## ## what happens with unknown characters: ## urnmess <- c(urndna,"n") seq <- sample( urnmess, 100, replace = TRUE ) ; seq s2n(seq) ## ## How to change the encoding for unknown characters: ## tmp <- s2n(seq) ; tmp[is.na(tmp)] <- -1; tmp ## ## Simple sanity check: ## stopifnot(all(s2n(s2c("acgt")) == 0:3))
This function retrieves all sequence names or all accession number from an ACNUC list and saves them into a file.
savelist(lrank, type = c("N", "A"), filename = paste(gln(lrank), ifelse(type == "N", "mne", "acc"), sep = "."),socket = autosocket(), warnme = TRUE)savelist(lrank, type = c("N", "A"), filename = paste(gln(lrank), ifelse(type == "N", "mne", "acc"), sep = "."),socket = autosocket(), warnme = TRUE)
lrank |
the rank of the ACNUC list to consider. |
type |
use "N" for sequence names (mnemonics) and "A" for accession numbers. Default is "N". |
filename |
a string of character giving the name of the file to save results. |
socket |
an object of class |
warnme |
if TRUE a message is issued on the console when complete. |
none.
J.R. Lobry
https://doua.prabi.fr/databases/acnuc.html
citation("seqinr")
choosebank, query, glr to
get a list rank from its name, clfcd for the inverse operation
of savelist
## Not run: ### Need internet connection choosebank("emblTP") mylist <- query("mylist", "sp=felis catus et t=cds", virtual=TRUE) savelist(glr("mylist")) # 603 sequence mnemonics written into file: MYLIST.mne savelist(glr("mylist"), type = "A") # 603 sequence accession numbers written into file: MYLIST.acc ## End(Not run)## Not run: ### Need internet connection choosebank("emblTP") mylist <- query("mylist", "sp=felis catus et t=cds", virtual=TRUE) savelist(glr("mylist")) # 603 sequence mnemonics written into file: MYLIST.mne savelist(glr("mylist"), type = "A") # 603 sequence accession numbers written into file: MYLIST.acc ## End(Not run)
as.SeqAcnucWeb is called by many functions, for instance by query,
and should not be directly called by the user. It creates an object of class SeqAcnucWeb.
is.SeqAcnucWeb returns TRUE if the object is of class SeqAcnucWeb.
as.SeqAcnucWeb(object, length, frame, ncbigc) is.SeqAcnucWeb(object)as.SeqAcnucWeb(object, length, frame, ncbigc) is.SeqAcnucWeb(object)
object |
a string giving the name of a sequence present in the data base |
length |
a string giving the length of the sequence present in the data base |
frame |
a string giving the frame of the sequence present in the data base |
ncbigc |
a string giving the ncbi genetic code of the sequence present in the data base |
as.SeqAcnucWeb returns an object sequence of class SeqAcnucWeb. Note
that as from seqinR 1.1-3 the slot socket has been deleted to save space for long lists.
D. Charif, J.R. Lobry
citation("seqinr")
## Not run: # Need internet connection choosebank("emblTP") mylist <- query("mylist", "sp=felis catus et t=cds et o=mitochondrion") stopifnot(is.SeqAcnucWeb(mylist$req[[1]])) closebank() ## End(Not run)## Not run: # Need internet connection choosebank("emblTP") mylist <- query("mylist", "sp=felis catus et t=cds et o=mitochondrion") stopifnot(is.SeqAcnucWeb(mylist$req[[1]])) closebank() ## End(Not run)
as.SeqFastaAA is called by the function as read.fasta. It creates an object of class SeqFastaAA.
is.SeqFastaAA returns TRUE if the object is of class SeqFastaAA.
summary.SeqFastaAA gives the AA composition of an object of class SeqFastaAA.
as.SeqFastaAA(object, name = NULL, Annot = NULL) is.SeqFastaAA(object) ## S3 method for class 'SeqFastaAA' summary(object,...)as.SeqFastaAA(object, name = NULL, Annot = NULL) is.SeqFastaAA(object) ## S3 method for class 'SeqFastaAA' summary(object,...)
object |
a vector of chars representing a biological sequence |
name |
|
Annot |
|
... |
additional arguments affecting the summary produced |
as.SeqFastaAA returns an object sequence of class SeqFastaAA.
summary.SeqFastaAA returns a list which the following components:
composition |
the AA counting of the sequence |
AA.Property |
the percentage of each group of amino acid in the sequence. By example, the groups are small, tiny, aliphatic, aromatic ... |
D. Charif
citation("seqinr")
s <- read.fasta(file = system.file("sequences/seqAA.fasta", package = "seqinr"), seqtype="AA") is.SeqFastaAA(s[[1]]) summary(s[[1]]) myseq <- s2c("MSPTAYRRGSPAFLV*") as.SeqFastaAA(myseq, name = "myseq", Annot = "blablabla") myseqs <- read.fasta(file = system.file("sequences/seqAA.fasta", package = "seqinr"), seqtype="AA") is.SeqFastaAA(s[[1]]) summary(s[[1]]) myseq <- s2c("MSPTAYRRGSPAFLV*") as.SeqFastaAA(myseq, name = "myseq", Annot = "blablabla") myseq
as.SeqFastadna is called by many functions as read.fasta. It creates an object of class SeqFastadna.
is.SeqFastadna returns TRUE if the object is of class SeqFastadna.
summary.SeqFastadna gives the base composition of an object of class SeqFastadna.
as.SeqFastadna(object, name = NULL, Annot = NULL) is.SeqFastadna(object) ## S3 method for class 'SeqFastadna' summary(object, alphabet = s2c("acgt"), ...)as.SeqFastadna(object, name = NULL, Annot = NULL) is.SeqFastadna(object) ## S3 method for class 'SeqFastadna' summary(object, alphabet = s2c("acgt"), ...)
object |
a vector of chars representing a biological sequence |
name |
|
Annot |
|
... |
additional arguments affecting the summary produced |
alphabet |
a vector of single characters |
as.SeqFastadna returns an object sequence of class SeqFastadna.
summary.SeqFastadna returns a list which the following components:
length |
the legth of the sequence |
compo |
the base counting of the sequence |
GC |
the percentage of G+C in the sequence |
D. Charif
citation("seqinr")
s <- read.fasta(system.file("sequences/malM.fasta",package="seqinr")) is.SeqFastadna(s[[1]]) summary(s[[1]]) myseq <- s2c("acgttgatgctagctagcatcgat") as.SeqFastadna(myseq, name = "myseq", Annot = "blablabla") myseqs <- read.fasta(system.file("sequences/malM.fasta",package="seqinr")) is.SeqFastadna(s[[1]]) summary(s[[1]]) myseq <- s2c("acgttgatgctagctagcatcgat") as.SeqFastadna(myseq, name = "myseq", Annot = "blablabla") myseq
as.SeqFrag is called by all methods of getFrag, but not directly by the users. It creates an object sequence of class SeqFrag.
as.SeqFrag(object, begin, end, name) is.SeqFrag(object)as.SeqFrag(object, begin, end, name) is.SeqFrag(object)
object |
an object sequence of class |
begin |
the first base of the fragment to get |
end |
the last base of the fragment to get |
name |
the name of the sequence |
as.SeqFrag returns a biological sequence with the following attributes:
seqMother |
the name of the sequence from which the sequence comes |
begin |
the position of the first base of the fragment on the mother sequence |
end |
the position of the last base of the fragment on the mother sequence |
class |
|
is.SeqFrag returns TRUE if the object is of class Seqfrag.
D. Charif, J.R. Lobry
citation("seqinr")
getFrag, getLength, getName,
getSequence, getTrans
s <- read.fasta(file = system.file("sequences/malM.fasta", package = "seqinr")) getFrag(s[[1]], 1, 10)s <- read.fasta(file = system.file("sequences/malM.fasta", package = "seqinr")) getFrag(s[[1]], 1, 10)
This data set gives the genetics code, the name of each codon, the IUPAC one-letter code for amino acids and the physico-chemical class of amino acid and the pK values of amino acids described in Bjellqvist et al. (1993).
SEQINR.UTIL is a list containing the 4 following objects:
is a data frame containing the genetics code : The standard ('Universal') genetic code with a selection of non-standard codes.
is a three columns data frame. The first column is a factor containing the codon. The second column is a factor giving the aminoacids names for each codon. The last column is a factor giving the IUPAC one-letter code for aminoacids
is a list giving the physico-chemical class of amino acid. The differents classes are the following one : Tiny, Small, Aliphatic, Aromatic, Non.polar, Polar, Charged, Basic, Acidic
is a data frame. It gives the pK values of amino acids described in Bjellqvist et al. (1993) , which were defined by examining polypeptide migration between pH 4.5 to 7.3 in an immobilised pH gradient gel environment with 9.2M and 9.8M urea at 15 degree or 25 degree
Data prepared by D. Charif.
The genetic codes have been taken from the ncbi database: https://www.ncbi.nlm.nih.gov/Taxonomy/Utils/wprintgc.cgi. Last visited on 2016-10-05 corresponding to last update of the Genetic Codes: April 30, 2013.
The IUPAC one-letter code for aminoacids is descibed at: https://www.bioinformatics.org/sms/iupac.html.
pK values of amino acids were taken from Bjellqvist et al.
Bjellqvist, B.,Hughes, G.J., Pasquali, Ch., Paquet, N., Ravier, F., Sanchez, J.-Ch., Frutiger, S. & Hochstrasser, D.F.(1993) The focusing positions of polypeptides in immobilized pH gradients can be predicted from their amino acid sequences. Electrophoresis, 14, 1023-1031.
citation("seqinr")
data(SEQINR.UTIL)data(SEQINR.UTIL)
This is a low level function to set the name of a list from an ACNUC server. It should not be used directly by end users.
setlistname(lrank, name = "list1", socket = autosocket())setlistname(lrank, name = "list1", socket = autosocket())
lrank |
the list rank on the ACNUC server |
name |
the name to use for this list |
socket |
an object of class |
A single numeric value corresponding to:
NA |
Empty answer from server. |
0 |
OK. |
3 |
if another list with that name already existed and was deleted. |
4 |
no list of rank |
J.R. Lobry
https://doua.prabi.fr/databases/acnuc.html
citation("seqinr")
## Not run: ### Need internet connection choosebank("emblTP") mylist <- query("mylist", "sp=felis catus et t=CDS", virtual = TRUE) # Change list name on server: setlistname(lrank = glr("mylist"), name = "feliscatus") # 0, OK. glr("mylist") # 0, list doesn't exist no more. glr("feliscatus") # 2, this list exists. # Note the danger here: the object mylist is still present in the user workspace # while the corresponding list was deleted from server. ## End(Not run)## Not run: ### Need internet connection choosebank("emblTP") mylist <- query("mylist", "sp=felis catus et t=CDS", virtual = TRUE) # Change list name on server: setlistname(lrank = glr("mylist"), name = "feliscatus") # 0, OK. glr("mylist") # 0, list doesn't exist no more. glr("feliscatus") # 2, this list exists. # Note the danger here: the object mylist is still present in the user workspace # while the corresponding list was deleted from server. ## End(Not run)
Split a sequence into sub-sequences of 3 (the default size) with no overlap between the sub-sequences.
splitseq(seq, frame = 0, word = 3)splitseq(seq, frame = 0, word = 3)
seq |
a vector of chars |
frame |
an integer (0, 1, 2) giving the starting position to split the sequence |
word |
an integer giving the size of the sub-sequences |
This function returns a vector which contains the sub-sequences.
J.R. Lobry
citation("seqinr")
cds <- s2c("aacgttgcaggtcgctcgctacgtagctactgttt") # # To obtain the codon sequence in frame 0: # stopifnot(identical(splitseq(cds), c("aac", "gtt", "gca", "ggt", "cgc", "tcg", "cta", "cgt", "agc", "tac", "tgt"))) # # Show the effect of frame and word with a ten char sequence: # (tenchar <- s2c("1234567890")) splitseq(tenchar, frame = 0) splitseq(tenchar, frame = 1) splitseq(tenchar, frame = 2) splitseq(tenchar, frame = 0, word = 2) splitseq(tenchar, frame = 0, word = 1)cds <- s2c("aacgttgcaggtcgctcgctacgtagctactgttt") # # To obtain the codon sequence in frame 0: # stopifnot(identical(splitseq(cds), c("aac", "gtt", "gca", "ggt", "cgc", "tcg", "cta", "cgt", "agc", "tac", "tgt"))) # # Show the effect of frame and word with a ten char sequence: # (tenchar <- s2c("1234567890")) splitseq(tenchar, frame = 0) splitseq(tenchar, frame = 1) splitseq(tenchar, frame = 2) splitseq(tenchar, frame = 0, word = 2) splitseq(tenchar, frame = 0, word = 1)
This function returns a vector of strings in which LaTeX special characters are escaped, this was useful in conjunction with xtable.
stresc(strings)stresc(strings)
strings |
A vector of strings to deal with. |
Returns a vector of strings with escaped characters within each string.
J.R. Lobry
citation("seqinr")
stresc("MISC_RNA") stresc(c("BB_0001","BB_0002"))stresc("MISC_RNA") stresc(c("BB_0001","BB_0002"))
This function tries to estimate the stutter ratio, either in terms of peak heigth ratios or peak surface ratio.
stutterabif(abifdata, chanel, poswild, datapointbefore = 70, datapointafter = 20, datapointsigma = 3.5, chanel.names = c(1:4, 105), DATA = paste("DATA", chanel.names[chanel], sep = "."), maxrfu = 1000, method = "monoH.FC", pms = 6, fig = FALSE)stutterabif(abifdata, chanel, poswild, datapointbefore = 70, datapointafter = 20, datapointsigma = 3.5, chanel.names = c(1:4, 105), DATA = paste("DATA", chanel.names[chanel], sep = "."), maxrfu = 1000, method = "monoH.FC", pms = 6, fig = FALSE)
abifdata |
the result returned by |
chanel |
the dye number |
poswild |
the position in datapoint units of the allele at
the origin of the stutter product, typically obtained after a call to |
datapointbefore |
how many datapoints before |
datapointafter |
how many datapoints after |
datapointsigma |
initial guess for the standard deviation of a peak |
chanel.names |
numbers extensions used for the DATA |
DATA |
names of the DATA components |
maxrfu |
argument passed to |
method |
method to be used by |
pms |
how many standard deviations (after gaussian fit) before and after the mean peak values should be considered for spline function interpolation |
fig |
should a summary plot be produced? |
FIXME, See R code for now
A list with the following components:
rh |
Stutter ratio computed as the height of the stutter divided by the height of its corresponding allele |
rs |
Stutter ratio computed as the surface of the stutter divided by the surface of its corresponding allele |
h1 |
The height of the stutter with baseline at 0 |
h2 |
The height of the allele with baseline at 0 |
s1 |
The surface of the stutter |
s2 |
The surface of the allele |
p |
A list of additional parameter that could be usesfull, see example |
J.R. Lobry
JLO for a dataset example,
peakabif to get an estimate of peak location.
# # Load pre-defined dataset, same as what would be obtained with read.abif: # data(JLO) # # Get peak locations in the blue channel: # maxis <- peakabif(JLO, 1, npeak = 6, tmin = 3, fig = FALSE)$maxis # # Compute stutter ratio for first peak and ask for a figure: # tmp <- stutterabif(JLO, 1, maxis[1], fig = TRUE) # # Show in addition the normal approximation used at the stutter peak: # xx <- seq(tmp$p$mu1 - 6*tmp$p$sd1, tmp$p$mu1 + 6*tmp$p$sd1, le = 100) lines(xx, tmp$p$p1*dnorm(xx, tmp$p$mu1, tmp$p$sd1), col = "darkgreen") # # Show in addition the normal approximation used at allele peak: # xx <- seq(tmp$p$mu2 - 6*tmp$p$sd2, tmp$p$mu2 + 6*tmp$p$sd2, le = 100) lines(xx, tmp$p$p2*dnorm(xx, tmp$p$mu2, tmp$p$sd2), col = "darkgreen")# # Load pre-defined dataset, same as what would be obtained with read.abif: # data(JLO) # # Get peak locations in the blue channel: # maxis <- peakabif(JLO, 1, npeak = 6, tmin = 3, fig = FALSE)$maxis # # Compute stutter ratio for first peak and ask for a figure: # tmp <- stutterabif(JLO, 1, maxis[1], fig = TRUE) # # Show in addition the normal approximation used at the stutter peak: # xx <- seq(tmp$p$mu1 - 6*tmp$p$sd1, tmp$p$mu1 + 6*tmp$p$sd1, le = 100) lines(xx, tmp$p$p1*dnorm(xx, tmp$p$mu1, tmp$p$sd1), col = "darkgreen") # # Show in addition the normal approximation used at allele peak: # xx <- seq(tmp$p$mu2 - 6*tmp$p$sd2, tmp$p$mu2 + 6*tmp$p$sd2, le = 100) lines(xx, tmp$p$p2*dnorm(xx, tmp$p$mu2, tmp$p$sd2), col = "darkgreen")
Exchange object x with object y.
swap(x, y)swap(x, y)
x |
an R object |
y |
an R object |
none.
J.R. Lobry
citation("seqinr")
# # Example in a new empty environment: # local({ x <- 0:9 y <- 10:19 print(x) print(y) swap(x[1], y[2]) print(x) print(y) }) # # Sanity check with a bubble sort: # bubble.sort <- function(tab, n = length(tab)){ i <- 1 while(i < n){ if(tab[i + 1] < tab[i]){ swap(tab[i], tab[i+1]) i <- 1 } else { i <- i+1 } } return(tab) } set.seed(1) x <- rnorm(10) stopifnot(identical(sort(x), bubble.sort(x)))# # Example in a new empty environment: # local({ x <- 0:9 y <- 10:19 print(x) print(y) swap(x[1], y[2]) print(x) print(y) }) # # Sanity check with a bubble sort: # bubble.sort <- function(tab, n = length(tab)){ i <- 1 while(i < n){ if(tab[i + 1] < tab[i]){ swap(tab[i], tab[i+1]) i <- 1 } else { i <- i+1 } } return(tab) } set.seed(1) x <- rnorm(10) stopifnot(identical(sort(x), bubble.sort(x)))
Returns all synonymous codons for each codon given
syncodons(codons, numcode = 1)syncodons(codons, numcode = 1)
codons |
A sequence of codons as generated by |
numcode |
The genetic code number as in |
a list containing, for each codon given (list tags), all synonymous codons (including the original one)
L. Palmeira, J.R. Lobry
citation("seqinr")
# # The four synonymous codons for Alanine in the standard genetic code: # syncodons("ggg") # # With a sequence: # toycds <- s2c("tctgagcaaataaatcgg") syncodons(splitseq(toycds)) # # Sanity check with the standard genetic code: # stdgencode <- structure(list( ttt = c("ttc", "ttt"), ttc = c("ttc", "ttt"), tta = c("cta", "ctc", "ctg", "ctt", "tta", "ttg"), ttg = c("cta", "ctc", "ctg", "ctt", "tta", "ttg"), tct = c("agc", "agt", "tca", "tcc", "tcg", "tct"), tcc = c("agc", "agt", "tca", "tcc", "tcg", "tct"), tca = c("agc", "agt", "tca", "tcc", "tcg", "tct"), tcg = c("agc", "agt", "tca", "tcc", "tcg", "tct"), tat = c("tac", "tat"), tac = c("tac", "tat"), taa = c("taa", "tag", "tga"), tag = c("taa", "tag", "tga"), tgt = c("tgc", "tgt"), tgc = c("tgc", "tgt"), tga = c("taa", "tag", "tga"), tgg = "tgg", ctt = c("cta", "ctc", "ctg", "ctt", "tta", "ttg"), ctc = c("cta", "ctc", "ctg", "ctt", "tta", "ttg"), cta = c("cta", "ctc", "ctg", "ctt", "tta", "ttg"), ctg = c("cta", "ctc", "ctg", "ctt", "tta", "ttg"), cct = c("cca", "ccc", "ccg", "cct"), ccc = c("cca", "ccc", "ccg", "cct"), cca = c("cca", "ccc", "ccg", "cct"), ccg = c("cca", "ccc", "ccg", "cct"), cat = c("cac", "cat"), cac = c("cac", "cat"), caa = c("caa", "cag"), cag = c("caa", "cag"), cgt = c("aga", "agg", "cga", "cgc", "cgg", "cgt"), cgc = c("aga", "agg", "cga", "cgc", "cgg", "cgt"), cga = c("aga", "agg", "cga", "cgc", "cgg", "cgt"), cgg = c("aga", "agg", "cga", "cgc", "cgg", "cgt"), att = c("ata", "atc", "att"), atc = c("ata", "atc", "att"), ata = c("ata", "atc", "att"), atg = "atg", act = c("aca", "acc", "acg", "act"), acc = c("aca", "acc", "acg", "act"), aca = c("aca", "acc", "acg", "act"), acg = c("aca", "acc", "acg", "act"), aat = c("aac", "aat"), aac = c("aac", "aat"), aaa = c("aaa", "aag"), aag = c("aaa", "aag"), agt = c("agc", "agt", "tca", "tcc", "tcg", "tct"), agc = c("agc", "agt", "tca", "tcc", "tcg", "tct"), aga = c("aga", "agg", "cga", "cgc", "cgg", "cgt"), agg = c("aga", "agg", "cga", "cgc", "cgg", "cgt"), gtt = c("gta", "gtc", "gtg", "gtt"), gtc = c("gta", "gtc", "gtg", "gtt"), gta = c("gta", "gtc", "gtg", "gtt"), gtg = c("gta", "gtc", "gtg", "gtt"), gct = c("gca", "gcc", "gcg", "gct"), gcc = c("gca", "gcc", "gcg", "gct"), gca = c("gca", "gcc", "gcg", "gct"), gcg = c("gca", "gcc", "gcg", "gct"), gat = c("gac", "gat"), gac = c("gac", "gat"), gaa = c("gaa", "gag"), gag = c("gaa", "gag"), ggt = c("gga", "ggc", "ggg", "ggt"), ggc = c("gga", "ggc", "ggg", "ggt"), gga = c("gga", "ggc", "ggg", "ggt"), ggg = c("gga", "ggc", "ggg", "ggt")), .Names = c("ttt", "ttc", "tta", "ttg", "tct", "tcc", "tca", "tcg", "tat", "tac", "taa", "tag", "tgt", "tgc", "tga", "tgg", "ctt", "ctc", "cta", "ctg", "cct", "ccc", "cca", "ccg", "cat", "cac", "caa", "cag", "cgt", "cgc", "cga", "cgg", "att", "atc", "ata", "atg", "act", "acc", "aca", "acg", "aat", "aac", "aaa", "aag", "agt", "agc", "aga", "agg", "gtt", "gtc", "gta", "gtg", "gct", "gcc", "gca", "gcg", "gat", "gac", "gaa", "gag", "ggt", "ggc", "gga", "ggg")) # # Now the check: # currentresult <- syncodons(words(alphabet = s2c("tcag"))) stopifnot(identical(stdgencode, currentresult))# # The four synonymous codons for Alanine in the standard genetic code: # syncodons("ggg") # # With a sequence: # toycds <- s2c("tctgagcaaataaatcgg") syncodons(splitseq(toycds)) # # Sanity check with the standard genetic code: # stdgencode <- structure(list( ttt = c("ttc", "ttt"), ttc = c("ttc", "ttt"), tta = c("cta", "ctc", "ctg", "ctt", "tta", "ttg"), ttg = c("cta", "ctc", "ctg", "ctt", "tta", "ttg"), tct = c("agc", "agt", "tca", "tcc", "tcg", "tct"), tcc = c("agc", "agt", "tca", "tcc", "tcg", "tct"), tca = c("agc", "agt", "tca", "tcc", "tcg", "tct"), tcg = c("agc", "agt", "tca", "tcc", "tcg", "tct"), tat = c("tac", "tat"), tac = c("tac", "tat"), taa = c("taa", "tag", "tga"), tag = c("taa", "tag", "tga"), tgt = c("tgc", "tgt"), tgc = c("tgc", "tgt"), tga = c("taa", "tag", "tga"), tgg = "tgg", ctt = c("cta", "ctc", "ctg", "ctt", "tta", "ttg"), ctc = c("cta", "ctc", "ctg", "ctt", "tta", "ttg"), cta = c("cta", "ctc", "ctg", "ctt", "tta", "ttg"), ctg = c("cta", "ctc", "ctg", "ctt", "tta", "ttg"), cct = c("cca", "ccc", "ccg", "cct"), ccc = c("cca", "ccc", "ccg", "cct"), cca = c("cca", "ccc", "ccg", "cct"), ccg = c("cca", "ccc", "ccg", "cct"), cat = c("cac", "cat"), cac = c("cac", "cat"), caa = c("caa", "cag"), cag = c("caa", "cag"), cgt = c("aga", "agg", "cga", "cgc", "cgg", "cgt"), cgc = c("aga", "agg", "cga", "cgc", "cgg", "cgt"), cga = c("aga", "agg", "cga", "cgc", "cgg", "cgt"), cgg = c("aga", "agg", "cga", "cgc", "cgg", "cgt"), att = c("ata", "atc", "att"), atc = c("ata", "atc", "att"), ata = c("ata", "atc", "att"), atg = "atg", act = c("aca", "acc", "acg", "act"), acc = c("aca", "acc", "acg", "act"), aca = c("aca", "acc", "acg", "act"), acg = c("aca", "acc", "acg", "act"), aat = c("aac", "aat"), aac = c("aac", "aat"), aaa = c("aaa", "aag"), aag = c("aaa", "aag"), agt = c("agc", "agt", "tca", "tcc", "tcg", "tct"), agc = c("agc", "agt", "tca", "tcc", "tcg", "tct"), aga = c("aga", "agg", "cga", "cgc", "cgg", "cgt"), agg = c("aga", "agg", "cga", "cgc", "cgg", "cgt"), gtt = c("gta", "gtc", "gtg", "gtt"), gtc = c("gta", "gtc", "gtg", "gtt"), gta = c("gta", "gtc", "gtg", "gtt"), gtg = c("gta", "gtc", "gtg", "gtt"), gct = c("gca", "gcc", "gcg", "gct"), gcc = c("gca", "gcc", "gcg", "gct"), gca = c("gca", "gcc", "gcg", "gct"), gcg = c("gca", "gcc", "gcg", "gct"), gat = c("gac", "gat"), gac = c("gac", "gat"), gaa = c("gaa", "gag"), gag = c("gaa", "gag"), ggt = c("gga", "ggc", "ggg", "ggt"), ggc = c("gga", "ggc", "ggg", "ggt"), gga = c("gga", "ggc", "ggg", "ggt"), ggg = c("gga", "ggc", "ggg", "ggt")), .Names = c("ttt", "ttc", "tta", "ttg", "tct", "tcc", "tca", "tcg", "tat", "tac", "taa", "tag", "tgt", "tgc", "tga", "tgg", "ctt", "ctc", "cta", "ctg", "cct", "ccc", "cca", "ccg", "cat", "cac", "caa", "cag", "cgt", "cgc", "cga", "cgg", "att", "atc", "ata", "atg", "act", "acc", "aca", "acg", "aat", "aac", "aaa", "aag", "agt", "agc", "aga", "agg", "gtt", "gtc", "gta", "gtg", "gct", "gcc", "gca", "gcg", "gat", "gac", "gaa", "gag", "ggt", "ggc", "gga", "ggg")) # # Now the check: # currentresult <- syncodons(words(alphabet = s2c("tcag"))) stopifnot(identical(stdgencode, currentresult))
Generates a random synonymous coding sequence, according to a certain codon usage bias
synsequence(sequence, numcode = 1, ucoweight = NULL)synsequence(sequence, numcode = 1, ucoweight = NULL)
sequence |
A nucleic acids sequence |
numcode |
The genetic code number as in |
ucoweight |
A list of weights containing the desired codon usage
bias as generated by |
a sequence translating to the same protein sequence as the original
one (cf. translate), but containing synonymous codons
L. Palmeira
citation("seqinr")
data(ec999) sequence=ec999[1][[1]] synsequence(sequence,1,ucoweight(sequence))data(ec999) sequence=ec999[1][[1]] synsequence(sequence,1,ucoweight(sequence))
This function plots a genetic code table as in textbooks, that is
following the order T > C > A > G so that synonymous codons
are almost always in the same boxes.
tablecode(numcode = 1, urn.rna = s2c("TCAG"), dia = FALSE, latexfile = NULL, label = latexfile, size = "normalsize", caption = NULL, preaa = rep("", 64), postaa = rep("", 64), precodon = preaa, postcodon = postaa)tablecode(numcode = 1, urn.rna = s2c("TCAG"), dia = FALSE, latexfile = NULL, label = latexfile, size = "normalsize", caption = NULL, preaa = rep("", 64), postaa = rep("", 64), precodon = preaa, postcodon = postaa)
numcode |
The genetic code number as in |
urn.rna |
The letters to display codons, use s2c("UCAG") if you want the code in terms of RNA sequence |
latexfile |
The name of a LaTex file if you want to redirect the output |
label |
The label for the LaTeX table |
size |
The LaTex size of characters for the LaTeX table |
preaa |
A string to insert before the amino-acid in the LaTeX table |
postaa |
A string to insert after the amino-acid in the LaTeX table |
precodon |
A string to insert before the codon in the LaTeX table |
postcodon |
A string to insert after the codon in the LaTeX table |
caption |
The caption of the LaTeX table |
dia |
to produce a yellow/blue plot for slides |
The codon order for preaa, postaa, precodon, and
postcodon should be the same as in
paste(paste(rep(s2c("tcag"), each =16), s2c("tcag"), sep = ""), rep(s2c("tcag"), each = 4), sep = "")
J.R. Lobry
citation("seqinr")
# # Show me the standard genetic code: # tablecode()# # Show me the standard genetic code: # tablecode()
This test uses columns (codons) factor scores computed by recstat in order
to determine if the regions located between two Stop codons correspond to putative CDSs.
test.co.recstat(rec, fac = 1, length.min = 150, stop.max = 0.2, win.lim = 0.8, direct = TRUE, level = 0.01)test.co.recstat(rec, fac = 1, length.min = 150, stop.max = 0.2, win.lim = 0.8, direct = TRUE, level = 0.01)
rec |
list of elements returned by |
fac |
axis of the CA to use for test (4 |
length.min |
minimal length between two Stop codons. |
stop.max |
threshold for Stop codons relative position in a window to determine if this window can be used for test computation. |
win.lim |
minimum proportion of windows inside a region showing a p-value below the threshold for Kruskal-Wallis test. |
direct |
a logical for the choice of direct or reverse strand. |
level |
p-value threshold for Kruskal-Wallis test. |
The test is computed for all windows located between two Stop codons separated by at least
length.min nucleotides. For each window inside a region considered, a Kruskal-Wallis test
is computed on the factor scores of the codons found in this window, this for the three possible
reading frames. If a proportion of at least win.lim windows in the region reject the null
hypothesis of means equality between the reading frames, then, there is a good probability that
a CDS is located in the region.
Inside the first and the last windows of a region submitted to the test, the relative position of
the two Stop codons is used to determine if those windows can be used in the analysis. If the
first Stop is located within the stop.max fraction of the 5' end of the window, then this
window is kept in the analysis. In the same way, if the second Stop is located within the
stop.max fraction of the 3' end of the window, this window is also kept in the analysis.
The result is returned as a list containing three matrices (one for each reading frame).
All matrices have the same structure, with rows corresponding to the regions between
two Stop codons. Columns Start and End give the location of starting and ending
positions of the region; and CDS is a binary indicator equal to 1 if a putative CDS is
predicted, and to 0 if not.
O. Clerc, G. Perrière
## Not run: # CPU time is too long with windows ff <- system.file("sequences/ECOUNC.fsa", package = "seqinr") seq <- read.fasta(ff) rec <- recstat(seq[[1]], seqname = getName(seq)) test.co.recstat(rec) ## End(Not run)## Not run: # CPU time is too long with windows ff <- system.file("sequences/ECOUNC.fsa", package = "seqinr") seq <- read.fasta(ff) rec <- recstat(seq[[1]], seqname = getName(seq)) test.co.recstat(rec) ## End(Not run)
This test uses rows (windows) factor scores computed by recstat in order to
determine if the regions located between two Stop codons correspond to putative CDSs.
test.li.recstat(rec, fac = 1, length.min = 150, stop.max = 0.2, direct = TRUE, level = 0.05)test.li.recstat(rec, fac = 1, length.min = 150, stop.max = 0.2, direct = TRUE, level = 0.05)
rec |
list of elements returned by |
fac |
axis of the CA to use for test (4 |
length.min |
minimal length between two Stop codons. |
stop.max |
threshold for Stop codons relative position in a window to determine if this window can be used for test computation. |
direct |
a logical for the choice of direct or reverse strand. |
level |
p-value threshold for t-test. |
The test is computed for all regions between two Stop codons separated by at least
length.min nucleotides, this for the three possible reading frames of a DNA strand. For
each region considered, two t-tests are computed for comparing the mean of the factor scores of
the windows from the reading frame in which the region is located with the means of the factor
scores from the corresponding windows in the two other reading frames. If both t-tests reject
the null hypothesis of means equality, then there is a good probability that a CDS is located in
the region.
Inside the first and the last windows of a region submitted to the test, the relative position of
the two Stop codons is used to determine if those windows can be used in the analysis. If the
first Stop is located within the stop.max fraction of the 5' end of the window, then this
window is kept in the analysis. In the same way, if the second Stop is located within the
stop.max fraction of the 3' end of the window, this window is also kept in the analysis.
The result is returned as a list containing three matrices (one for each reading frame).
All matrices have the same structure, with rows corresponding to the regions between two Stop
codons. Columns Start and End give the location of starting and ending positions
of the region; Mean i gives the mean of the factor scores for the windows located in the
region, this for reading frame i; t(i,j) gives the p-value of the t-test computed
between the means from reading frames i and j; and CDS is a binary
indicator equal to 1 if a putative CDS is predicted, and to 0 if not.
O. Clerc, G. Perrière
ff <- system.file("sequences/ECOUNC.fsa", package = "seqinr") seq <- read.fasta(ff) rec <- recstat(seq[[1]], seqname = getName(seq)) test.li.recstat(rec)ff <- system.file("sequences/ECOUNC.fsa", package = "seqinr") seq <- read.fasta(ff) rec <- recstat(seq[[1]], seqname = getName(seq)) test.li.recstat(rec)
This is a toy data set to illustrate the importance of metric choice.
data(toyaa)data(toyaa)
A data frame with 3 observations on the following 3 variables:
Alanine counts
Valine counts
Cysteine counts
This toy example was inspired by Gautier, C: Analyses statistiques et évolution des séquences d'acides nucléiques. PhD thesis (1987), Université Claude Bernard - Lyon I.
citation("seqinr")
data(toyaa)data(toyaa)
This is a toy data set to illustrate synonymous and non-synonymous codon usage analyses.
data(toyaa)data(toyaa)
A data frame with 3 observations (coding sequences) for 10 codons.
Created for release 1.0-4 of seqinr's vignette.
citation("seqinr")
data(toycodon)data(toycodon)
This function translates nucleic acid sequences into the corresponding peptide sequence. It can translate in any of the 3 forward or three reverse sense frames. In the case of reverse sense, the reverse-complement of the sequence is taken. It can translate using the standard (universal) genetic code and also with non-standard codes. Ambiguous bases can also be handled.
translate(seq, frame = 0, sens = "F", numcode = 1, NAstring = "X", ambiguous = FALSE, force.first.aa.to.Met = FALSE)translate(seq, frame = 0, sens = "F", numcode = 1, NAstring = "X", ambiguous = FALSE, force.first.aa.to.Met = FALSE)
seq |
the sequence to translate as a vector of single characters in lower case letters. |
frame |
Frame(s) (0,1,2) to translate. By default the frame |
sens |
Sense to translate: |
numcode |
The ncbi genetic code number for translation. By default the standard genetic code is used. |
NAstring |
How to translate amino-acids when there are ambiguous bases in codons. |
ambiguous |
If TRUE, ambiguous bases are taken into account so that for instance GGN is translated to Gly in the standard genetic code. |
force.first.aa.to.Met |
If TRUE, the first codon in the sequence will be translated to Methionine regardless of the codon in order to treat rare start codons like TTG. |
The following genetic codes are described here. The number preceding each code
corresponds to numcode.
standard
vertebrate.mitochondrial
yeast.mitochondrial
protozoan.mitochondrial+mycoplasma
invertebrate.mitochondrial
ciliate+dasycladaceal
echinoderm+flatworm.mitochondrial
euplotid
bacterial+plantplastid
alternativeyeast
ascidian.mitochondrial
alternativeflatworm.mitochondrial
blepharism
chlorophycean.mitochondrial
trematode.mitochondrial
scenedesmus.mitochondrial
thraustochytrium.mitochondria
Pterobranchia.mitochondrial
CandidateDivision.SR1+Gracilibacteria
Pachysolen.tannophilus
translate returns a vector of single characters containing the peptide sequence in
the standard one-letter IUPAC code. Termination (STOP) codons are translated by
the character '*'.
D. Charif, J.R. Lobry
The genetic codes have been taken from the ncbi taxonomy database:
https://www.ncbi.nlm.nih.gov/Taxonomy/Utils/wprintgc.cgi.
Last update October 05, 2000.
The IUPAC one-letter code for aminoacids is described at:
https://www.bioinformatics.org/sms/iupac.html
citation("seqinr")
Use tolower to change upper case letters into lower case letters.
For coding sequences obtained from an ACNUC server with query it's
better to use the function getTrans so that the relevant genetic
code and the relevant frame are automatically used.
The genetic codes are given in the object SEQINR.UTIL, a more
human readable form is given by the function tablecode.
Use aaa to get the three-letter code for amino-acids.
## ## Toy CDS example invented by Leonor Palmeira: ## toycds <- s2c("tctgagcaaataaatcgg") translate(seq = toycds) # should be c("S", "E", "Q", "I", "N", "R") translate(seq = toycds, force.first.aa.to.Met = TRUE) # should be c("M", "E", "Q", "I", "N", "R") ## ## Toy CDS example with ambiguous bases: ## toycds2 <- s2c("tcngarcarathaaycgn") translate(toycds2) # should be c("X", "X", "X", "X", "X", "X") translate(toycds2, ambiguous = TRUE) # should be c("S", "E", "Q", "I", "N", "R") translate(toycds2, ambiguous = TRUE, numcode = 2) # should be c("S", "E", "Q", "X", "N", "R") ## ## Real CDS example: ## realcds <- read.fasta(file = system.file("sequences/malM.fasta", package ="seqinr"))[[1]] translate(seq = realcds) # Biologically correct, only one stop codon at the end translate(seq = realcds, frame = 3, sens = "R", numcode = 6) # Biologically meaningless, note the in-frame stop codons # Read from an alignment as suggested by Dr. H. Suzuki fasta.res <- read.alignment(file = system.file("sequences/Anouk.fasta", package = "seqinr"), format = "fasta") AA1 <- seqinr::getTrans(s2c(fasta.res$seq[[1]])) AA2 <- seqinr::translate(s2c(fasta.res$seq[[1]])) identical(AA1, AA2) AA1 <- lapply(fasta.res$seq, function(x) seqinr::getTrans(s2c(x))) AA2 <- lapply(fasta.res$seq, function(x) seqinr::translate(s2c(x))) identical(AA1, AA2) ## Not run: ## Need internet connection. ## Translation of the following EMBL entry: ## ## FT CDS join(complement(153944..154157),complement(153727..153866), ## FT complement(152185..153037),138523..138735,138795..138955) ## FT /codon_start=1 ## FT /db_xref="FLYBASE:FBgn0002781" ## FT /db_xref="GOA:Q86B86" ## FT /db_xref="TrEMBL:Q86B86" ## FT /note="mod(mdg4) gene product from transcript CG32491-RZ; ## FT trans splicing" ## FT /gene="mod(mdg4)" ## FT /product="CG32491-PZ" ## FT /locus_tag="CG32491" ## FT /protein_id="AAO41581.1" ## FT /translation="MADDEQFSLCWNNFNTNLSAGFHESLCRGDLVDVSLAAEGQIVKA ## FT HRLVLSVCSPFFRKMFTQMPSNTHAIVFLNNVSHSALKDLIQFMYCGEVNVKQDALPAF ## FT ISTAESLQIKGLTDNDPAPQPPQESSPPPAAPHVQQQQIPAQRVQRQQPRASARYKIET ## FT VDDGLGDEKQSTTQIVIQTTAAPQATIVQQQQPQQAAQQIQSQQLQTGTTTTATLVSTN ## FT KRSAQRSSLTPASSSAGVKRSKTSTSANVMDPLDSTTETGATTTAQLVPQQITVQTSVV ## FT SAAEAKLHQQSPQQVRQEEAEYIDLPMELPTKSEPDYSEDHGDAAGDAEGTYVEDDTYG ## FT DMRYDDSYFTENEDAGNQTAANTSGGGVTATTSKAVVKQQSQNYSESSFVDTSGDQGNT ## FT EAQVTQHVRNCGPQMFLISRKGGTLLTINNFVYRSNLKFFGKSNNILYWECVQNRSVKC ## FT RSRLKTIGDDLYVTNDVHNHMGDNKRIEAAKAAGMLIHKKLSSLTAADKIQGSWKMDTE ## FT GNPDHLPKM" choosebank("emblTP") trans <- query("trans", "N=AE003734.PE35") trans1 <- getTrans(trans$req[[1]]) ## Complex transsplicing operations, the correct frame and the correct ## genetic code are automatically used for translation into protein. seq <- getSequence(trans$req[[1]]) identical(translate(seq),trans1) #default frame and genetic code are correct trans <- query("trans", "N=AB004237") trans1 <- getTrans(trans$req[[1]]) ## Complex transsplicing operations, the correct frame and the correct ## genetic code are automatically used for translation into protein. seq <- getSequence(trans$req[[1]]) identical(translate(seq),trans1) #default genetic code is not correct identical(translate(seq,numcode=2),trans1) #genetic code is 2 ## End(Not run)## ## Toy CDS example invented by Leonor Palmeira: ## toycds <- s2c("tctgagcaaataaatcgg") translate(seq = toycds) # should be c("S", "E", "Q", "I", "N", "R") translate(seq = toycds, force.first.aa.to.Met = TRUE) # should be c("M", "E", "Q", "I", "N", "R") ## ## Toy CDS example with ambiguous bases: ## toycds2 <- s2c("tcngarcarathaaycgn") translate(toycds2) # should be c("X", "X", "X", "X", "X", "X") translate(toycds2, ambiguous = TRUE) # should be c("S", "E", "Q", "I", "N", "R") translate(toycds2, ambiguous = TRUE, numcode = 2) # should be c("S", "E", "Q", "X", "N", "R") ## ## Real CDS example: ## realcds <- read.fasta(file = system.file("sequences/malM.fasta", package ="seqinr"))[[1]] translate(seq = realcds) # Biologically correct, only one stop codon at the end translate(seq = realcds, frame = 3, sens = "R", numcode = 6) # Biologically meaningless, note the in-frame stop codons # Read from an alignment as suggested by Dr. H. Suzuki fasta.res <- read.alignment(file = system.file("sequences/Anouk.fasta", package = "seqinr"), format = "fasta") AA1 <- seqinr::getTrans(s2c(fasta.res$seq[[1]])) AA2 <- seqinr::translate(s2c(fasta.res$seq[[1]])) identical(AA1, AA2) AA1 <- lapply(fasta.res$seq, function(x) seqinr::getTrans(s2c(x))) AA2 <- lapply(fasta.res$seq, function(x) seqinr::translate(s2c(x))) identical(AA1, AA2) ## Not run: ## Need internet connection. ## Translation of the following EMBL entry: ## ## FT CDS join(complement(153944..154157),complement(153727..153866), ## FT complement(152185..153037),138523..138735,138795..138955) ## FT /codon_start=1 ## FT /db_xref="FLYBASE:FBgn0002781" ## FT /db_xref="GOA:Q86B86" ## FT /db_xref="TrEMBL:Q86B86" ## FT /note="mod(mdg4) gene product from transcript CG32491-RZ; ## FT trans splicing" ## FT /gene="mod(mdg4)" ## FT /product="CG32491-PZ" ## FT /locus_tag="CG32491" ## FT /protein_id="AAO41581.1" ## FT /translation="MADDEQFSLCWNNFNTNLSAGFHESLCRGDLVDVSLAAEGQIVKA ## FT HRLVLSVCSPFFRKMFTQMPSNTHAIVFLNNVSHSALKDLIQFMYCGEVNVKQDALPAF ## FT ISTAESLQIKGLTDNDPAPQPPQESSPPPAAPHVQQQQIPAQRVQRQQPRASARYKIET ## FT VDDGLGDEKQSTTQIVIQTTAAPQATIVQQQQPQQAAQQIQSQQLQTGTTTTATLVSTN ## FT KRSAQRSSLTPASSSAGVKRSKTSTSANVMDPLDSTTETGATTTAQLVPQQITVQTSVV ## FT SAAEAKLHQQSPQQVRQEEAEYIDLPMELPTKSEPDYSEDHGDAAGDAEGTYVEDDTYG ## FT DMRYDDSYFTENEDAGNQTAANTSGGGVTATTSKAVVKQQSQNYSESSFVDTSGDQGNT ## FT EAQVTQHVRNCGPQMFLISRKGGTLLTINNFVYRSNLKFFGKSNNILYWECVQNRSVKC ## FT RSRLKTIGDDLYVTNDVHNHMGDNKRIEAAKAAGMLIHKKLSSLTAADKIQGSWKMDTE ## FT GNPDHLPKM" choosebank("emblTP") trans <- query("trans", "N=AE003734.PE35") trans1 <- getTrans(trans$req[[1]]) ## Complex transsplicing operations, the correct frame and the correct ## genetic code are automatically used for translation into protein. seq <- getSequence(trans$req[[1]]) identical(translate(seq),trans1) #default frame and genetic code are correct trans <- query("trans", "N=AB004237") trans1 <- getTrans(trans$req[[1]]) ## Complex transsplicing operations, the correct frame and the correct ## genetic code are automatically used for translation into protein. seq <- getSequence(trans$req[[1]]) identical(translate(seq),trans1) #default genetic code is not correct identical(translate(seq,numcode=2),trans1) #genetic code is 2 ## End(Not run)
This function removes from a character vector the longest successive run of space characters starting at the begining of the strings (leading space), or the longest successive run of space characters at the end of the strings (trailing space), or both (and this is the default behaviour).
trimSpace(x, leading = TRUE, trailing = TRUE, space = "[:space:]")trimSpace(x, leading = TRUE, trailing = TRUE, space = "[:space:]")
x |
a character vector |
leading |
logical defaulting to |
trailing |
logical defaulting to |
space |
an extended regular expression defining space characters |
The default value for the space character definition is large: in addition to the usual space, other character such as the tabulation and newline character are considered as space characters. See extended regular expression for a complete list.
a character vector with the same length as x.
J.R. Lobry
citation("seqinr").
Extended regular expressionsare described in regular expression
(aka regexp).
# # Simple use: # stopifnot( trimSpace(" seqinR ") == "seqinR" ) # # Basic use, remove space at both ends: # testspace <- c(" with leading space", "with trailing space ", " with both ") stopifnot(all( trimSpace(testspace) == c("with leading space", "with trailing space", "with both"))) # # Remove only leading space: # stopifnot(all( trimSpace(testspace, trailing = FALSE) == c("with leading space", "with trailing space ", "with both "))) # # Remove only trailing space: # stopifnot(all( trimSpace(testspace, leading = FALSE) == c(" with leading space", "with trailing space", " with both"))) # # This should do nothing: # stopifnot(all( trimSpace(testspace, leading = FALSE, trailing = FALSE) == testspace)) # # How to use alternative space characters: # allspaces <- "\t\n\f\r seqinR \t\n\f\r" stopifnot(trimSpace(allspaces) == "seqinR") stopifnot(trimSpace(allspaces, space = "\t\n") == "\f\r seqinR \t\n\f\r")# # Simple use: # stopifnot( trimSpace(" seqinR ") == "seqinR" ) # # Basic use, remove space at both ends: # testspace <- c(" with leading space", "with trailing space ", " with both ") stopifnot(all( trimSpace(testspace) == c("with leading space", "with trailing space", "with both"))) # # Remove only leading space: # stopifnot(all( trimSpace(testspace, trailing = FALSE) == c("with leading space", "with trailing space ", "with both "))) # # Remove only trailing space: # stopifnot(all( trimSpace(testspace, leading = FALSE) == c(" with leading space", "with trailing space", " with both"))) # # This should do nothing: # stopifnot(all( trimSpace(testspace, leading = FALSE, trailing = FALSE) == testspace)) # # How to use alternative space characters: # allspaces <- "\t\n\f\r seqinR \t\n\f\r" stopifnot(trimSpace(allspaces) == "seqinR") stopifnot(trimSpace(allspaces, space = "\t\n") == "\f\r seqinR \t\n\f\r")
uco calculates some codon usage indices: the codon counts eff, the relative frequencies freq or the Relative Synonymous Codon Usage rscu.
uco(seq, frame = 0, index = c("eff", "freq", "rscu"), as.data.frame = FALSE, NA.rscu = NA)uco(seq, frame = 0, index = c("eff", "freq", "rscu"), as.data.frame = FALSE, NA.rscu = NA)
seq |
a coding sequence as a vector of chars |
frame |
an integer (0, 1, 2) giving the frame of the coding sequence |
index |
codon usage index choice, partial matching is allowed.
"eff", "freq", and "rscu" correspond to "R0", "R1", and "R3", respectively, in Suzuki et al. (2005) "2.2 Normalization of codon usage data". "eff" and "rscu" correspond to "AF" and "RSCU", respectively, in Suzuki et al. (2008) "2.2. Definitions of codon usage data". |
as.data.frame |
logical. If |
NA.rscu |
when an amino-acid is missing, RSCU are no more defined and repported
as missing values ( |
Codons with ambiguous bases are ignored.
RSCU is a simple measure of non-uniform usage of synonymous codons in a coding sequence
(Sharp et al. 1986).
RSCU values are the number of times a particular codon is observed, relative to the number
of times that the codon would be observed for a uniform synonymous codon usage (i.e. all the
codons for a given amino-acid have the same probability).
In the absence of any codon usage bias, the RSCU values would be 1.00 (this is the case
for sequence cds in the exemple thereafter). A codon that is used
less frequently than expected will have an RSCU value of less than 1.00 and vice versa for a codon
that is used more frequently than expected.
Do not use correspondence analysis on RSCU tables as this is a source of artifacts
(Perrière and Thioulouse 2002, Suzuki et al. 2008). Within-aminoacid correspondence analysis is a
simple way to study synonymous codon usage (Charif et al. 2005). For an introduction
to correspondence analysis and within-aminoacid correspondence analysis see the
chapter titled Multivariate analyses in the seqinR manual that ships with the
seqinR package in the doc folder. You can also use internal correspondence
analysis if you want to analyze simultaneously a row-block structure such as the
within and between species variability (Lobry and Chessel 2003).
If as.data.frame is FALSE, uco returns one of these:
a table of codon counts
a table of codon relative frequencies
a numeric vector of relative synonymous codon usage values
If as.data.frame is TRUE, uco returns a data frame with five columns:
a vector containing the name of amino-acid
a vector containing the corresponding codon
a numeric vector of codon counts
a numeric vector of codon relative frequencies
a numeric vector of RSCU index
If as.data.frame is FALSE, the default, a table for eff and freq and
a numeric vector for rscu. If as.data.frame is TRUE,
a data frame with all indices is returned.
D. Charif, J.R. Lobry, G. Perrière
citation("seqinr")
Sharp, P.M., Tuohy, T.M.F., Mosurski, K.R. (1986) Codon usage in yeast: cluster
analysis clearly differentiates highly and lowly expressed genes.
Nucl. Acids. Res., 14:5125-5143.
Perrière, G., Thioulouse, J. (2002) Use and misuse of correspondence analysis in
codon usage studies. Nucl. Acids. Res., 30:4548-4555.
Lobry, J.R., Chessel, D. (2003) Internal correspondence analysis of codon and
amino-acid usage in thermophilic bacteria.
Journal of Applied Genetics, 44:235-261. http://jag.igr.poznan.pl/2003-Volume-44/2/pdf/2003_Volume_44_2-235-261.pdf.
Charif, D., Thioulouse, J., Lobry, J.R., Perrière, G. (2005) Online
Synonymous Codon Usage Analyses with the ade4 and seqinR packages.
Bioinformatics, 21:545-547. https://pbil.univ-lyon1.fr/members/lobry/repro/bioinfo04/.
Suzuki, H., Saito, R. Tomita, R. (2005)
A problem in multivariate analysis of codon usage data and a possible solution.
FEBS Lett., 579:6499-504. https://www.thermofisher.com/de/de/home/brands/applied-biosystems.html.
Suzuki, H., Brown, C.J., Forney, L.J., Top, E. (2008) Comparison of Correspondence Analysis Methods for Synonymous Codon Usage in Bacteria. DNA Research, 15:357-365. doi:10.1093/dnares/dsn028.
## Show all possible codons: words() ## Make a coding sequence from this: (cds <- s2c(paste(words(), collapse = ""))) ## Get codon counts: uco(cds, index = "eff") ## Get codon relative frequencies: uco(cds, index = "freq") ## Get RSCU values: uco(cds, index = "rscu") ## Show what happens with ambiguous bases: uco(s2c("aaannnttt")) ## Use a real coding sequence: rcds <- read.fasta(file = system.file("sequences/malM.fasta", package = "seqinr"))[[1]] uco( rcds, index = "freq") uco( rcds, index = "eff") uco( rcds, index = "rscu") uco( rcds, as.data.frame = TRUE) ## Show what happens with RSCU when an amino-acid is missing: ecolicgpe5 <- read.fasta(file = system.file("sequences/ecolicgpe5.fasta",package="seqinr"))[[1]] uco(ecolicgpe5, index = "rscu") ## Force NA to zero: uco(ecolicgpe5, index = "rscu", NA.rscu = 0)## Show all possible codons: words() ## Make a coding sequence from this: (cds <- s2c(paste(words(), collapse = ""))) ## Get codon counts: uco(cds, index = "eff") ## Get codon relative frequencies: uco(cds, index = "freq") ## Get RSCU values: uco(cds, index = "rscu") ## Show what happens with ambiguous bases: uco(s2c("aaannnttt")) ## Use a real coding sequence: rcds <- read.fasta(file = system.file("sequences/malM.fasta", package = "seqinr"))[[1]] uco( rcds, index = "freq") uco( rcds, index = "eff") uco( rcds, index = "rscu") uco( rcds, as.data.frame = TRUE) ## Show what happens with RSCU when an amino-acid is missing: ecolicgpe5 <- read.fasta(file = system.file("sequences/ecolicgpe5.fasta",package="seqinr"))[[1]] uco(ecolicgpe5, index = "rscu") ## Force NA to zero: uco(ecolicgpe5, index = "rscu", NA.rscu = 0)
Returns a list containing, for each of the 20 amino acids + STOP codon, the codon usage bias of each of the synonymous codon according to a given codon sequence.
ucoweight(sequence, numcode = 1)ucoweight(sequence, numcode = 1)
sequence |
A nucleic acids sequence |
numcode |
The genetic code number as in |
a list containing, for each of the 20 amino acids and STOP codon (list tags), the weight of each synonymous codon (including the original one).
L. Palmeira
citation("seqinr")
data(ec999) ucoweight(ec999[1][[1]])data(ec999) ucoweight(ec999[1][[1]])
The absorption of light by water is highly dependent on the wavelength, this dataset gives the absorption coefficients from 200 to 700 nm.
data(waterabs)data(waterabs)
A data.frame with 2 columns:
wavelength in nm
absorption coefficient in 1/cm
Data were compiled by Palmeira (2007) from the cited references.
The example section allows to reproduce the left part of figure 2.7 from Palmeira (2007):
Palmeira, L. (2007) Analyse et modélisation des dépendances entre
sites voisins dans l'évolution des séquences d'ADN, PhD thesis,
Université Claude Bernard - Lyon I.
Litjens R. A., Quickenden T. I. and Freeman C. G. (1999). Visible and
near-ultraviolet absorption spectrum of liquid water. Applied Optics,
38:1216-1223.
Quickenden T. I. & Irvin J. A. (1980). The ultraviolet absorption spectrum
of liquid water. The Journal of Chemical Physics, 72:4416-4428.
citation("seqinr")
data(waterabs) d <- 100*seq(from = 0, to = 150, by = 1) # depth in cm lambda <- waterabs$lambda # wavelength in nm abs <- waterabs$absorption # absorption coefficient cm-1 # # Smooth signal with cubic splines # tmp <- spline(lambda, abs, n = 255) lambda <- tmp$x abs <- tmp$y zun <- sapply(abs,function(x) 10^(-x*d)) z <- sapply(nrow(zun):1, function(x) zun[x,]) # # Set up world coordinates: # plot.new() plot.window(xlim = range(lambda), ylim = range(d), xaxs = "i", yaxs = "i") # # Annotate: # title(ylab = 'Depth under water surface (m)', xlab = "Wavelength (nm)", main = "Light absorption by the water column") axis(2 , at = seq(0, 15000, l = 7), labels = rev(c("0","25","50","75","100","125","150")), las = 1) axis(1,at=(3:6)*100,labels= TRUE) # # Show me rainbow colors: # alpha <- 1 coul=c(rep(rgb(1,1,1, alpha = alpha), 181), rev(hsv(h=seq(0,5/6,l=320),alpha = alpha))) rect(seq(200,699), 0, seq(201,700), 15000 , col = coul, border = coul) # # Grey scale: # ngris <- 5 image(x = lambda, y = d, z = z, col = rgb(1:ngris, 1:ngris, 1:ngris, alpha = 0.7*(ngris:1), max = ngris), axes = F, add = TRUE, breaks = seq(from = min(z), to = max(z), length = ngris + 1)) # # Contour lines: # contour(x = lambda, y = d, z = z, add = TRUE, drawlabels = TRUE,labcex= 0.75, col='black', levels = seq(from = min(z), to = max(z), length = ngris + 1)) box()data(waterabs) d <- 100*seq(from = 0, to = 150, by = 1) # depth in cm lambda <- waterabs$lambda # wavelength in nm abs <- waterabs$absorption # absorption coefficient cm-1 # # Smooth signal with cubic splines # tmp <- spline(lambda, abs, n = 255) lambda <- tmp$x abs <- tmp$y zun <- sapply(abs,function(x) 10^(-x*d)) z <- sapply(nrow(zun):1, function(x) zun[x,]) # # Set up world coordinates: # plot.new() plot.window(xlim = range(lambda), ylim = range(d), xaxs = "i", yaxs = "i") # # Annotate: # title(ylab = 'Depth under water surface (m)', xlab = "Wavelength (nm)", main = "Light absorption by the water column") axis(2 , at = seq(0, 15000, l = 7), labels = rev(c("0","25","50","75","100","125","150")), las = 1) axis(1,at=(3:6)*100,labels= TRUE) # # Show me rainbow colors: # alpha <- 1 coul=c(rep(rgb(1,1,1, alpha = alpha), 181), rev(hsv(h=seq(0,5/6,l=320),alpha = alpha))) rect(seq(200,699), 0, seq(201,700), 15000 , col = coul, border = coul) # # Grey scale: # ngris <- 5 image(x = lambda, y = d, z = z, col = rgb(1:ngris, 1:ngris, 1:ngris, alpha = 0.7*(ngris:1), max = ngris), axes = F, add = TRUE, breaks = seq(from = min(z), to = max(z), length = ngris + 1)) # # Contour lines: # contour(x = lambda, y = d, z = z, add = TRUE, drawlabels = TRUE,labcex= 0.75, col='black', levels = seq(from = min(z), to = max(z), length = ngris + 1)) box()
This function loops over all availabale ACNUC databases to look for a given sequence accession number. This is useful when you have a sequence accession number and you don't know in which database it is present.
where.is.this.acc(acc, stopAtFirst = TRUE, ...)where.is.this.acc(acc, stopAtFirst = TRUE, ...)
acc |
An accession number as a string of characters such as |
stopAtFirst |
Logical. If TRUE, the default, the function stops at the first database where the accession number is found. |
... |
Arguments passed to the function |
The function resturns invisibly a vector of strings of characters for the names of the ACNUC databases in which the accession number was found.
J.R. Lobry
citation("seqinr")
choosebank to open a given ACNUC database.
## Not run: # Need internet connection where.is.this.acc("NC_001416") # first found in phever2dna bank (2016-06-01) ## End(Not run)## Not run: # Need internet connection where.is.this.acc("NC_001416") # first found in phever2dna bank (2016-06-01) ## End(Not run)
Generates a vectors of all the words from a given alphabet,
with right positions varying faster, for instance if the
alphabet is (c("0","1") and the length
is 2 you will obtain c("00", "01", "10", "11")
words(length = 3, alphabet = s2c("acgt"))words(length = 3, alphabet = s2c("acgt"))
length |
the number of characters in the words |
alphabet |
a vector of characters |
A vector of string whith length characters.
J.R. Lobry
citation("seqinr")
# # Get all 64 codons: # stopifnot(all(words() == c("aaa", "aac", "aag", "aat", "aca", "acc", "acg", "act", "aga", "agc", "agg", "agt", "ata", "atc", "atg", "att","caa", "cac", "cag", "cat", "cca", "ccc", "ccg", "cct", "cga", "cgc", "cgg", "cgt", "cta", "ctc", "ctg", "ctt", "gaa", "gac", "gag", "gat", "gca", "gcc", "gcg", "gct", "gga", "ggc", "ggg", "ggt", "gta", "gtc", "gtg", "gtt", "taa", "tac", "tag", "tat", "tca", "tcc", "tcg", "tct", "tga", "tgc", "tgg", "tgt", "tta", "ttc", "ttg", "ttt"))) # # Get all codons with u c a g for bases: # words(alphabet = s2c("ucag")) # # Get all tetranucleotides: # words(length = 4) # # Get all dipeptides: # words(length = 2, alphabet = a()[-1])# # Get all 64 codons: # stopifnot(all(words() == c("aaa", "aac", "aag", "aat", "aca", "acc", "acg", "act", "aga", "agc", "agg", "agt", "ata", "atc", "atg", "att","caa", "cac", "cag", "cat", "cca", "ccc", "ccg", "cct", "cga", "cgc", "cgg", "cgt", "cta", "ctc", "ctg", "ctt", "gaa", "gac", "gag", "gat", "gca", "gcc", "gcg", "gct", "gga", "ggc", "ggg", "ggt", "gta", "gtc", "gtg", "gtt", "taa", "tac", "tag", "tat", "tca", "tcc", "tcg", "tct", "tga", "tgc", "tgg", "tgt", "tta", "ttc", "ttg", "ttt"))) # # Get all codons with u c a g for bases: # words(alphabet = s2c("ucag")) # # Get all tetranucleotides: # words(length = 4) # # Get all dipeptides: # words(length = 2, alphabet = a()[-1])
word.pos searches all the occurences of the motif pattern
within the sequence text and returns their positions. This
function is based on regexp allowing thus for complex motif searches.
The main difference with gregexpr is that non disjoint matches
are reported here.
words.pos(pattern, text, ignore.case = FALSE, perl = TRUE, fixed = FALSE, useBytes = TRUE, ...)words.pos(pattern, text, ignore.case = FALSE, perl = TRUE, fixed = FALSE, useBytes = TRUE, ...)
pattern |
character string containing a regular expression (or character string for |
text |
a character vector where matches are sought. |
ignore.case |
if |
perl |
logical. Should perl-compatible regexps be used if available?
Has priority over |
fixed |
logical. If |
useBytes |
logical. If |
... |
arguments passed to |
Default parameter values have been tuned for speed when working biological sequences.
a vector of positions for which the motif pattern was
found in the sequence text.
J.R. Lobry
citation("seqinr")
myseq <- "tatagaga" words.pos("t", myseq) # Should be 1 3 words.pos("tag", myseq) # Should be 3 words.pos("ga", myseq) # Should be 5 7 # How to specify ambiguous base ? Look for YpR motifs by words.pos("[ct][ag]", myseq) # Should be 1 3 # # Show the difference with gregexpr: # words.pos("toto", "totototo") # 1 3 5 (three overlapping matches) unlist(gregexpr("toto", "totototo")) # 1 5 (two disjoint matches)myseq <- "tatagaga" words.pos("t", myseq) # Should be 1 3 words.pos("tag", myseq) # Should be 3 words.pos("ga", myseq) # Should be 5 7 # How to specify ambiguous base ? Look for YpR motifs by words.pos("[ct][ag]", myseq) # Should be 1 3 # # Show the difference with gregexpr: # words.pos("toto", "totototo") # 1 3 5 (three overlapping matches) unlist(gregexpr("toto", "totototo")) # 1 5 (two disjoint matches)
Writes one or more sequences into a file in FASTA format.
write.fasta(sequences, names, file.out, open = "w", nbchar = 60, as.string = FALSE)write.fasta(sequences, names, file.out, open = "w", nbchar = 60, as.string = FALSE)
sequences |
A DNA or protein sequence (in the form of a vector of single characters by default) or a list of such sequences. |
as.string |
FALSE. When set to TRUE sequences are in the form of strings instead of vectors of single characters. |
names |
The name(s) of the sequences. |
nbchar |
The number of characters per line (default: 60) |
file.out |
The name of the output file. |
open |
Mode to open the output file, use "w" to write into a new file, use "a" to append at the end of an already existing file. |
none.
A. Necşulea
citation("seqinr")
## Read 3 sequences from a FASTA file: ortho <- read.fasta(file = system.file("sequences/ortho.fasta", package = "seqinr")) ## Select only third codon positions: ortho3 <- lapply(ortho, function(x) x[seq(from = 3, to = length(x), by = 3)]) ## Write the 3 modified sequences to a file: fname <- tempfile(pattern = "ortho3", tmpdir = tempdir(), fileext = "fasta") #write.fasta(sequences = ortho3, names = names(ortho3), nbchar = 80, file.out = "ortho3.fasta") write.fasta(sequences = ortho3, names = names(ortho3), nbchar = 80, file.out = fname) ## Read them again from the same file and check that sequences are preserved: ortho3bis <- read.fasta(fname, set.attributes = FALSE) stopifnot(identical(ortho3bis, ortho3))## Read 3 sequences from a FASTA file: ortho <- read.fasta(file = system.file("sequences/ortho.fasta", package = "seqinr")) ## Select only third codon positions: ortho3 <- lapply(ortho, function(x) x[seq(from = 3, to = length(x), by = 3)]) ## Write the 3 modified sequences to a file: fname <- tempfile(pattern = "ortho3", tmpdir = tempdir(), fileext = "fasta") #write.fasta(sequences = ortho3, names = names(ortho3), nbchar = 80, file.out = "ortho3.fasta") write.fasta(sequences = ortho3, names = names(ortho3), nbchar = 80, file.out = fname) ## Read them again from the same file and check that sequences are preserved: ortho3bis <- read.fasta(fname, set.attributes = FALSE) stopifnot(identical(ortho3bis, ortho3))